Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NDM7

Protein Details
Accession G9NDM7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
270-296DLTVRVEAKKQRNKNTKQTRIVKKSVPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR037231  NAP-like_sf  
IPR002164  NAP_family  
Gene Ontology GO:0032174  C:cellular bud neck septin collar  
GO:1990317  C:Gin4 complex  
GO:0005634  C:nucleus  
GO:0030332  F:cyclin binding  
GO:0008047  F:enzyme activator activity  
GO:0042393  F:histone binding  
GO:0042802  F:identical protein binding  
GO:0051082  F:unfolded protein binding  
GO:0007117  P:budding cell bud growth  
GO:0006607  P:NLS-bearing protein import into nucleus  
GO:0006334  P:nucleosome assembly  
GO:0006337  P:nucleosome disassembly  
GO:2000617  P:positive regulation of histone H3-K9 acetylation  
GO:0031116  P:positive regulation of microtubule polymerization  
GO:0071902  P:positive regulation of protein serine/threonine kinase activity  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0098841  P:protein localization to cell division site after cytokinesis  
GO:0042274  P:ribosomal small subunit biogenesis  
Pfam View protein in Pfam  
PF00956  NAP  
Amino Acid Sequences MAEPIRNKRSDVSTAPTPQNTPATAAPISSRAQQPGVASIKEDDMERAAAASLLAQNPKLVQMIQGRLGSLIGQSSGYIESLPAPVRRRVSGLRAIQKDHAKLEAEFQEEVLQLEKKYFAKFTPLYEKRSAIVNGKVEPTEEEVKRGDEDDEESQEAAEAAGEPSQPTDEASEDVQGIPEFWLSAMKNQVTLAEMITDRDEAALKHLIDIRMEYLDKPGFRLIFEFAENEYFSDKTITKTYFYQNESGYGGDFIYDHAEGYKINWYPGKDLTVRVEAKKQRNKNTKQTRIVKKSVPTESFFNFFSPPKPPTDDADPEDDVASDIEERLELDYQLGEDIKEKLIPRAVDWFTGEALAYEEFDEDDMDGPDFDDDDEDEDDMSEDHDDDEESDEDDESGKPKQEAAECKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.55
4 0.51
5 0.48
6 0.47
7 0.41
8 0.36
9 0.31
10 0.3
11 0.27
12 0.26
13 0.23
14 0.23
15 0.24
16 0.25
17 0.27
18 0.25
19 0.26
20 0.28
21 0.27
22 0.31
23 0.34
24 0.29
25 0.26
26 0.25
27 0.25
28 0.24
29 0.24
30 0.17
31 0.14
32 0.15
33 0.13
34 0.12
35 0.1
36 0.09
37 0.09
38 0.09
39 0.1
40 0.12
41 0.14
42 0.14
43 0.14
44 0.15
45 0.16
46 0.16
47 0.13
48 0.16
49 0.21
50 0.24
51 0.29
52 0.29
53 0.27
54 0.26
55 0.26
56 0.21
57 0.15
58 0.12
59 0.07
60 0.07
61 0.06
62 0.07
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.1
69 0.13
70 0.17
71 0.2
72 0.25
73 0.28
74 0.29
75 0.32
76 0.34
77 0.37
78 0.42
79 0.46
80 0.5
81 0.51
82 0.53
83 0.54
84 0.56
85 0.52
86 0.45
87 0.4
88 0.33
89 0.29
90 0.32
91 0.3
92 0.27
93 0.24
94 0.23
95 0.22
96 0.2
97 0.2
98 0.17
99 0.14
100 0.11
101 0.12
102 0.15
103 0.15
104 0.16
105 0.17
106 0.16
107 0.23
108 0.24
109 0.29
110 0.36
111 0.39
112 0.43
113 0.45
114 0.46
115 0.38
116 0.42
117 0.39
118 0.32
119 0.33
120 0.29
121 0.28
122 0.29
123 0.28
124 0.23
125 0.22
126 0.22
127 0.24
128 0.21
129 0.22
130 0.21
131 0.22
132 0.22
133 0.22
134 0.18
135 0.11
136 0.15
137 0.14
138 0.16
139 0.15
140 0.15
141 0.13
142 0.13
143 0.12
144 0.08
145 0.06
146 0.04
147 0.04
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.07
158 0.08
159 0.08
160 0.08
161 0.08
162 0.08
163 0.07
164 0.07
165 0.06
166 0.05
167 0.05
168 0.04
169 0.07
170 0.07
171 0.09
172 0.12
173 0.12
174 0.13
175 0.13
176 0.13
177 0.11
178 0.11
179 0.09
180 0.07
181 0.07
182 0.07
183 0.08
184 0.07
185 0.06
186 0.06
187 0.07
188 0.05
189 0.08
190 0.11
191 0.1
192 0.11
193 0.14
194 0.14
195 0.14
196 0.14
197 0.12
198 0.1
199 0.11
200 0.1
201 0.11
202 0.12
203 0.12
204 0.13
205 0.14
206 0.13
207 0.13
208 0.14
209 0.12
210 0.12
211 0.12
212 0.12
213 0.1
214 0.12
215 0.12
216 0.11
217 0.1
218 0.09
219 0.08
220 0.1
221 0.1
222 0.11
223 0.15
224 0.16
225 0.16
226 0.19
227 0.24
228 0.28
229 0.29
230 0.31
231 0.27
232 0.28
233 0.27
234 0.24
235 0.19
236 0.13
237 0.11
238 0.07
239 0.07
240 0.06
241 0.07
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.07
248 0.13
249 0.11
250 0.13
251 0.16
252 0.17
253 0.19
254 0.21
255 0.24
256 0.2
257 0.21
258 0.23
259 0.28
260 0.3
261 0.29
262 0.36
263 0.4
264 0.49
265 0.56
266 0.61
267 0.64
268 0.72
269 0.78
270 0.81
271 0.84
272 0.84
273 0.85
274 0.87
275 0.88
276 0.85
277 0.83
278 0.78
279 0.73
280 0.71
281 0.69
282 0.62
283 0.54
284 0.5
285 0.46
286 0.43
287 0.37
288 0.3
289 0.25
290 0.22
291 0.22
292 0.23
293 0.23
294 0.24
295 0.29
296 0.29
297 0.31
298 0.38
299 0.41
300 0.38
301 0.42
302 0.38
303 0.34
304 0.32
305 0.27
306 0.2
307 0.15
308 0.12
309 0.07
310 0.07
311 0.06
312 0.06
313 0.06
314 0.07
315 0.08
316 0.08
317 0.08
318 0.08
319 0.08
320 0.09
321 0.09
322 0.08
323 0.09
324 0.11
325 0.11
326 0.14
327 0.15
328 0.18
329 0.22
330 0.23
331 0.23
332 0.29
333 0.3
334 0.28
335 0.29
336 0.27
337 0.22
338 0.22
339 0.2
340 0.12
341 0.12
342 0.1
343 0.09
344 0.08
345 0.08
346 0.07
347 0.08
348 0.08
349 0.07
350 0.08
351 0.08
352 0.08
353 0.08
354 0.08
355 0.08
356 0.08
357 0.08
358 0.08
359 0.07
360 0.09
361 0.1
362 0.1
363 0.1
364 0.1
365 0.1
366 0.09
367 0.1
368 0.08
369 0.07
370 0.07
371 0.08
372 0.08
373 0.08
374 0.12
375 0.12
376 0.12
377 0.13
378 0.12
379 0.12
380 0.13
381 0.13
382 0.12
383 0.15
384 0.17
385 0.17
386 0.19
387 0.25
388 0.31
389 0.39