Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NCY9

Protein Details
Accession G9NCY9    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-32LTQVTKKTREQKDQLFQNIREHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR033867  Mrt4  
IPR043141  Ribosomal_L10-like_sf  
IPR001790  Ribosomal_L10P  
IPR043164  RL10_insert_sf  
IPR040637  RL10P_insert  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0030687  C:preribosome, large subunit precursor  
GO:0032040  C:small-subunit processome  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
GO:0000027  P:ribosomal large subunit assembly  
GO:0000055  P:ribosomal large subunit export from nucleus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF00466  Ribosomal_L10  
PF17777  RL10P_insert  
CDD cd05796  Ribosomal_P0_like  
Amino Acid Sequences MPKSKRAKVFHLTQVTKKTREQKDQLFQNIREQVPEYQHCFVFNVDNMRNNYLKDVRRELSDSRLFFGKTKLMAKALGQTAEEAIVPGIEGLAPHITGTVGLLLTNRPVDSVLDYLNSIAPVDFARAGVTASRSFTIPPGVVYATGGEVPKENDIPLQHTIEPELRRLGVPTRMVKGKVVLGDESGEGEGYTVCKEGEVLDSRQTRLLKLFDVCLSEFRVKVLAYWSAATNEVTEIDQAAMDGVEEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.68
4 0.67
5 0.67
6 0.66
7 0.71
8 0.73
9 0.73
10 0.76
11 0.8
12 0.83
13 0.81
14 0.73
15 0.72
16 0.7
17 0.6
18 0.52
19 0.46
20 0.4
21 0.4
22 0.43
23 0.39
24 0.35
25 0.36
26 0.34
27 0.32
28 0.29
29 0.25
30 0.23
31 0.26
32 0.25
33 0.31
34 0.32
35 0.35
36 0.35
37 0.32
38 0.35
39 0.34
40 0.37
41 0.36
42 0.4
43 0.38
44 0.4
45 0.43
46 0.4
47 0.41
48 0.43
49 0.38
50 0.33
51 0.35
52 0.32
53 0.29
54 0.3
55 0.25
56 0.22
57 0.24
58 0.24
59 0.23
60 0.23
61 0.23
62 0.26
63 0.24
64 0.21
65 0.18
66 0.17
67 0.15
68 0.15
69 0.14
70 0.08
71 0.06
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.06
93 0.06
94 0.05
95 0.06
96 0.06
97 0.07
98 0.08
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.07
105 0.06
106 0.05
107 0.05
108 0.04
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.07
117 0.07
118 0.08
119 0.08
120 0.08
121 0.09
122 0.09
123 0.1
124 0.09
125 0.08
126 0.09
127 0.08
128 0.08
129 0.08
130 0.08
131 0.06
132 0.08
133 0.07
134 0.06
135 0.07
136 0.08
137 0.09
138 0.09
139 0.08
140 0.09
141 0.1
142 0.13
143 0.15
144 0.17
145 0.16
146 0.16
147 0.18
148 0.21
149 0.22
150 0.2
151 0.18
152 0.17
153 0.16
154 0.18
155 0.19
156 0.19
157 0.23
158 0.25
159 0.28
160 0.3
161 0.31
162 0.3
163 0.29
164 0.27
165 0.24
166 0.23
167 0.19
168 0.16
169 0.16
170 0.15
171 0.14
172 0.11
173 0.09
174 0.07
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.07
184 0.12
185 0.15
186 0.17
187 0.24
188 0.27
189 0.28
190 0.33
191 0.33
192 0.29
193 0.29
194 0.29
195 0.25
196 0.25
197 0.27
198 0.24
199 0.26
200 0.26
201 0.23
202 0.26
203 0.25
204 0.24
205 0.21
206 0.22
207 0.19
208 0.19
209 0.21
210 0.19
211 0.18
212 0.2
213 0.2
214 0.19
215 0.21
216 0.2
217 0.17
218 0.14
219 0.13
220 0.12
221 0.11
222 0.1
223 0.09
224 0.09
225 0.08
226 0.07
227 0.06
228 0.06