Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MT03

Protein Details
Accession A0A4S8MT03    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-104NCAICWNRKKNKQRLPDGRWRRRTNHydrophilic
NLS Segment(s)
PositionSequence
88-101KKNKQRLPDGRWRR
Subcellular Location(s) cyto 10, nucl 7, pero 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004242  Transposase_21  
Pfam View protein in Pfam  
PF02992  Transposase_21  
Amino Acid Sequences MFLAGLIPGPSEPAPEEVGSYIQPLVDTLLTLWHRGVRFSKTYLYPYERLIRAALVCVVCDLPAARKIGGFVAGWKHDVNCAICWNRKKNKQRLPDGRWRRRTNEETREWARRYVEARSRAERDACFSQSGVRCSELLRLPYFDPTRMIVIDSMHNLFLGLFKEHTRNVLGLKSNKKKRDEGGKSMSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.14
5 0.15
6 0.14
7 0.14
8 0.12
9 0.1
10 0.09
11 0.09
12 0.09
13 0.08
14 0.08
15 0.07
16 0.13
17 0.14
18 0.15
19 0.15
20 0.17
21 0.18
22 0.21
23 0.24
24 0.23
25 0.26
26 0.28
27 0.33
28 0.32
29 0.35
30 0.38
31 0.41
32 0.37
33 0.38
34 0.42
35 0.37
36 0.35
37 0.32
38 0.27
39 0.22
40 0.21
41 0.2
42 0.13
43 0.12
44 0.11
45 0.11
46 0.09
47 0.09
48 0.08
49 0.07
50 0.1
51 0.12
52 0.11
53 0.11
54 0.12
55 0.12
56 0.14
57 0.12
58 0.1
59 0.12
60 0.13
61 0.14
62 0.14
63 0.14
64 0.13
65 0.15
66 0.15
67 0.12
68 0.16
69 0.18
70 0.23
71 0.28
72 0.36
73 0.42
74 0.5
75 0.59
76 0.65
77 0.7
78 0.75
79 0.8
80 0.82
81 0.81
82 0.82
83 0.84
84 0.83
85 0.84
86 0.79
87 0.73
88 0.71
89 0.71
90 0.7
91 0.68
92 0.63
93 0.6
94 0.61
95 0.63
96 0.56
97 0.51
98 0.43
99 0.37
100 0.34
101 0.35
102 0.37
103 0.37
104 0.4
105 0.43
106 0.45
107 0.44
108 0.45
109 0.38
110 0.36
111 0.33
112 0.3
113 0.26
114 0.23
115 0.27
116 0.27
117 0.28
118 0.24
119 0.21
120 0.2
121 0.2
122 0.25
123 0.22
124 0.22
125 0.22
126 0.22
127 0.22
128 0.29
129 0.3
130 0.26
131 0.24
132 0.23
133 0.23
134 0.21
135 0.21
136 0.15
137 0.15
138 0.16
139 0.17
140 0.16
141 0.14
142 0.14
143 0.13
144 0.12
145 0.12
146 0.12
147 0.11
148 0.11
149 0.13
150 0.17
151 0.18
152 0.2
153 0.2
154 0.2
155 0.21
156 0.25
157 0.31
158 0.35
159 0.45
160 0.53
161 0.61
162 0.67
163 0.71
164 0.71
165 0.73
166 0.76
167 0.74
168 0.73
169 0.73