Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LW13

Protein Details
Accession A0A4S8LW13    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-82IITYQMKKKEKEKEKQHKASPSSLHydrophilic
NLS Segment(s)
PositionSequence
66-72KKEKEKE
Subcellular Location(s) cyto 16, plas 2, extr 2, pero 2, E.R. 2, nucl 1, mito 1, golg 1, mito_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPGTGEGATGESAGTAGAGIDTVGKGVGAIGNSSDADGVWKPFLIALGVGTIILGIVSIITYQMKKKEKEKEKQHKASPSSLSNTENA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.05
15 0.04
16 0.04
17 0.05
18 0.06
19 0.06
20 0.06
21 0.06
22 0.04
23 0.06
24 0.06
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.03
38 0.03
39 0.02
40 0.02
41 0.02
42 0.01
43 0.01
44 0.02
45 0.02
46 0.03
47 0.04
48 0.05
49 0.08
50 0.16
51 0.23
52 0.27
53 0.35
54 0.46
55 0.55
56 0.64
57 0.74
58 0.77
59 0.82
60 0.88
61 0.88
62 0.87
63 0.82
64 0.79
65 0.74
66 0.68
67 0.63
68 0.57