Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MVF0

Protein Details
Accession A0A4S8MVF0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-153EEDEEKPKKKKAPAKKKTEDGEEKPKKARAPRKVRAHCBasic
NLS Segment(s)
PositionSequence
121-150KPKKKKAPAKKKTEDGEEKPKKARAPRKVR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00645  zf-PARP  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MPSGYRFDYAPSNRAKCKGPKPCNGTTLPKGTLRHATMADFQGKPTSHYRHWGCVTKKIIENMKAQFPNADEVDGFEDLKPEDQDRIRKAWEDGEVAEEDIPESAKKTGAGEEEEEEDEEKPKKKKAPAKKKTEDGEEKPKKARAPRKVRAHC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.54
3 0.54
4 0.61
5 0.66
6 0.66
7 0.7
8 0.73
9 0.76
10 0.75
11 0.72
12 0.69
13 0.64
14 0.61
15 0.55
16 0.52
17 0.47
18 0.45
19 0.46
20 0.4
21 0.37
22 0.32
23 0.31
24 0.29
25 0.31
26 0.32
27 0.25
28 0.23
29 0.25
30 0.24
31 0.25
32 0.28
33 0.31
34 0.28
35 0.36
36 0.38
37 0.4
38 0.45
39 0.5
40 0.46
41 0.49
42 0.51
43 0.46
44 0.47
45 0.44
46 0.45
47 0.41
48 0.43
49 0.37
50 0.41
51 0.37
52 0.34
53 0.3
54 0.25
55 0.24
56 0.19
57 0.17
58 0.1
59 0.1
60 0.12
61 0.11
62 0.11
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.07
69 0.1
70 0.12
71 0.18
72 0.2
73 0.23
74 0.23
75 0.24
76 0.24
77 0.24
78 0.23
79 0.19
80 0.17
81 0.16
82 0.16
83 0.15
84 0.14
85 0.1
86 0.08
87 0.07
88 0.07
89 0.05
90 0.06
91 0.06
92 0.07
93 0.08
94 0.08
95 0.11
96 0.13
97 0.15
98 0.15
99 0.16
100 0.17
101 0.18
102 0.17
103 0.16
104 0.14
105 0.15
106 0.17
107 0.22
108 0.23
109 0.29
110 0.35
111 0.44
112 0.53
113 0.61
114 0.69
115 0.74
116 0.81
117 0.84
118 0.86
119 0.84
120 0.85
121 0.83
122 0.79
123 0.8
124 0.79
125 0.75
126 0.72
127 0.7
128 0.67
129 0.68
130 0.7
131 0.7
132 0.71
133 0.76