Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LD62

Protein Details
Accession A0A4S8LD62    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-40ESFICGKKKGKEREGKGQESBasic
66-133LELRKGKERKGEGRRRKKREGKGRKGKGRKGKWVGNGGGKKRKGKRREGKERKGKERKGKEREGKWVGBasic
NLS Segment(s)
PositionSequence
28-32KKGKE
69-130RKGKERKGEGRRRKKREGKGRKGKGRKGKWVGNGGGKKRKGKRREGKERKGKERKGKEREGK
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MLEVTEGLSASKPEIFHNIKESFICGKKKGKEREGKGQESNGWAGVGQRLAWGEAKGGLELGDGQLELRKGKERKGEGRRRKKREGKGRKGKGRKGKWVGNGGGKKRKGKRREGKERKGKERKGKEREGKWVGNGGSHSQEVFEIFQGNVWIRKVVKFNSEHYDIPQSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.26
4 0.33
5 0.33
6 0.32
7 0.32
8 0.34
9 0.32
10 0.35
11 0.37
12 0.36
13 0.43
14 0.49
15 0.59
16 0.65
17 0.68
18 0.72
19 0.74
20 0.8
21 0.8
22 0.78
23 0.72
24 0.66
25 0.58
26 0.51
27 0.45
28 0.34
29 0.25
30 0.18
31 0.15
32 0.13
33 0.11
34 0.08
35 0.08
36 0.08
37 0.09
38 0.1
39 0.09
40 0.08
41 0.1
42 0.1
43 0.09
44 0.09
45 0.08
46 0.07
47 0.07
48 0.06
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.06
55 0.07
56 0.15
57 0.16
58 0.21
59 0.28
60 0.32
61 0.42
62 0.52
63 0.62
64 0.66
65 0.76
66 0.82
67 0.83
68 0.88
69 0.87
70 0.86
71 0.87
72 0.87
73 0.87
74 0.88
75 0.89
76 0.89
77 0.88
78 0.86
79 0.85
80 0.81
81 0.8
82 0.77
83 0.73
84 0.69
85 0.66
86 0.62
87 0.6
88 0.59
89 0.55
90 0.56
91 0.54
92 0.56
93 0.58
94 0.64
95 0.64
96 0.69
97 0.73
98 0.76
99 0.83
100 0.87
101 0.89
102 0.9
103 0.92
104 0.92
105 0.92
106 0.9
107 0.89
108 0.89
109 0.89
110 0.87
111 0.88
112 0.87
113 0.82
114 0.83
115 0.8
116 0.71
117 0.62
118 0.59
119 0.49
120 0.42
121 0.37
122 0.3
123 0.25
124 0.23
125 0.21
126 0.15
127 0.15
128 0.14
129 0.13
130 0.11
131 0.1
132 0.09
133 0.11
134 0.12
135 0.14
136 0.15
137 0.15
138 0.18
139 0.18
140 0.23
141 0.28
142 0.29
143 0.35
144 0.36
145 0.4
146 0.44
147 0.47
148 0.44
149 0.43
150 0.48