Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KW04

Protein Details
Accession A0A4S8KW04    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-89SILAQRRPKKHACPDCRRRHRELFSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR018306  Phage_T5_Orf172_DNA-bd  
Pfam View protein in Pfam  
PF10544  T5orf172  
Amino Acid Sequences MRDDSGYIYVLEAAQTDIKKIGFTQRDPITRLKEWRRSCPSMDFALKSCFQCRRVKRTEKIVHSILAQRRPKKHACPDCRRRHRELFSVTARDADLVIFLANILA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.13
5 0.13
6 0.13
7 0.14
8 0.22
9 0.24
10 0.25
11 0.33
12 0.38
13 0.41
14 0.44
15 0.48
16 0.46
17 0.45
18 0.52
19 0.52
20 0.55
21 0.56
22 0.63
23 0.65
24 0.63
25 0.61
26 0.57
27 0.52
28 0.48
29 0.46
30 0.37
31 0.31
32 0.3
33 0.3
34 0.26
35 0.25
36 0.24
37 0.26
38 0.33
39 0.36
40 0.42
41 0.49
42 0.56
43 0.58
44 0.65
45 0.69
46 0.66
47 0.66
48 0.59
49 0.51
50 0.44
51 0.46
52 0.4
53 0.41
54 0.42
55 0.43
56 0.46
57 0.52
58 0.56
59 0.59
60 0.65
61 0.66
62 0.7
63 0.75
64 0.81
65 0.86
66 0.91
67 0.88
68 0.86
69 0.85
70 0.81
71 0.79
72 0.74
73 0.71
74 0.67
75 0.64
76 0.57
77 0.48
78 0.41
79 0.33
80 0.27
81 0.19
82 0.12
83 0.08
84 0.08
85 0.06