Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PYK4

Protein Details
Accession A0A4Y7PYK4    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-92LAPGPKLQKQYRQKFNRKTKLRSFKLHCTAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MKEASLLALSSAARRPTITAPFKLDLRSHIFLSAKTSKSKTRSLVFLPHFRSMIECTQEAHLAPGPKLQKQYRQKFNRKTKLRSFKLHCTAIKPTSRIQSPCEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.22
4 0.32
5 0.35
6 0.34
7 0.38
8 0.4
9 0.42
10 0.42
11 0.37
12 0.32
13 0.34
14 0.33
15 0.28
16 0.29
17 0.28
18 0.25
19 0.31
20 0.33
21 0.28
22 0.29
23 0.31
24 0.33
25 0.37
26 0.42
27 0.4
28 0.37
29 0.39
30 0.38
31 0.44
32 0.42
33 0.44
34 0.43
35 0.39
36 0.36
37 0.32
38 0.31
39 0.24
40 0.23
41 0.19
42 0.15
43 0.14
44 0.15
45 0.16
46 0.14
47 0.13
48 0.12
49 0.12
50 0.12
51 0.15
52 0.16
53 0.18
54 0.25
55 0.27
56 0.35
57 0.44
58 0.54
59 0.6
60 0.69
61 0.77
62 0.81
63 0.89
64 0.9
65 0.89
66 0.88
67 0.88
68 0.89
69 0.86
70 0.85
71 0.82
72 0.81
73 0.81
74 0.79
75 0.71
76 0.65
77 0.65
78 0.63
79 0.61
80 0.54
81 0.51
82 0.51
83 0.56
84 0.53