Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PTP7

Protein Details
Accession A0A4Y7PTP7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAKKDKKEKEDKKGAGKDKKPAKKSBasic
NLS Segment(s)
PositionSequence
3-25KKDKKEKEDKKGAGKDKKPAKKS
Subcellular Location(s) nucl 12, cyto_nucl 10, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR043323  PIN4  
IPR046357  PPIase_dom_sf  
IPR000297  PPIase_PpiC  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF13616  Rotamase_3  
PROSITE View protein in PROSITE  
PS50198  PPIC_PPIASE_2  
Amino Acid Sequences MAKKDKKEKEDKKGAGKDKKPAKKSSMVSNQPPAEEEGSKPKSSTKAALKPATAVNVRHILCEKHSKALEALQKIKDGERFDKVAQEYSEDKAKAGGSLGWMTRGSMVGPFQDAAFALQPSTLANPTLSPLVKTNFGYHIILVEGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.81
4 0.8
5 0.79
6 0.82
7 0.78
8 0.76
9 0.72
10 0.71
11 0.69
12 0.7
13 0.7
14 0.68
15 0.67
16 0.68
17 0.63
18 0.54
19 0.51
20 0.43
21 0.35
22 0.29
23 0.24
24 0.26
25 0.28
26 0.28
27 0.28
28 0.28
29 0.29
30 0.31
31 0.36
32 0.35
33 0.39
34 0.46
35 0.49
36 0.47
37 0.44
38 0.43
39 0.4
40 0.34
41 0.26
42 0.22
43 0.25
44 0.25
45 0.24
46 0.24
47 0.2
48 0.21
49 0.29
50 0.27
51 0.26
52 0.26
53 0.26
54 0.25
55 0.3
56 0.31
57 0.26
58 0.29
59 0.24
60 0.26
61 0.25
62 0.26
63 0.24
64 0.22
65 0.21
66 0.2
67 0.22
68 0.21
69 0.25
70 0.24
71 0.24
72 0.21
73 0.21
74 0.2
75 0.19
76 0.24
77 0.2
78 0.19
79 0.17
80 0.17
81 0.14
82 0.13
83 0.12
84 0.09
85 0.11
86 0.11
87 0.11
88 0.11
89 0.11
90 0.11
91 0.11
92 0.09
93 0.09
94 0.09
95 0.08
96 0.09
97 0.09
98 0.09
99 0.09
100 0.08
101 0.09
102 0.09
103 0.09
104 0.08
105 0.07
106 0.08
107 0.08
108 0.1
109 0.1
110 0.09
111 0.09
112 0.1
113 0.12
114 0.16
115 0.16
116 0.15
117 0.18
118 0.2
119 0.24
120 0.25
121 0.27
122 0.25
123 0.28
124 0.28
125 0.24
126 0.22
127 0.2