Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QLI2

Protein Details
Accession A0A4Y7QLI2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-36EDAKVTKDRSRRRGIKRVAQREPQBasic
NLS Segment(s)
PositionSequence
21-29RSRRRGIKR
Subcellular Location(s) cyto 10cyto_nucl 10, nucl 8, mito 4, pero 3
Family & Domain DBs
Amino Acid Sequences MGEQQFRHDYQGEDAKVTKDRSRRRGIKRVAQREPQENLLNRPRGRQGNFPRHECAWERDEAWMYDTVKSGFTLSVCAVVYFVGQGAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.33
4 0.35
5 0.35
6 0.35
7 0.44
8 0.5
9 0.6
10 0.67
11 0.71
12 0.78
13 0.81
14 0.81
15 0.83
16 0.84
17 0.81
18 0.79
19 0.74
20 0.71
21 0.65
22 0.6
23 0.55
24 0.46
25 0.44
26 0.43
27 0.45
28 0.38
29 0.38
30 0.39
31 0.39
32 0.4
33 0.44
34 0.46
35 0.51
36 0.55
37 0.56
38 0.54
39 0.49
40 0.5
41 0.44
42 0.38
43 0.3
44 0.27
45 0.24
46 0.23
47 0.24
48 0.21
49 0.2
50 0.2
51 0.18
52 0.18
53 0.19
54 0.17
55 0.16
56 0.16
57 0.15
58 0.12
59 0.11
60 0.12
61 0.11
62 0.13
63 0.12
64 0.12
65 0.11
66 0.1
67 0.1
68 0.08
69 0.08