Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MSZ8

Protein Details
Accession G9MSZ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-92LPSPRRRSRRSVEERERPKSSBasic
NLS Segment(s)
PositionSequence
77-81RRSRR
Subcellular Location(s) cysk 8, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MGIGMALGAMGRGAMPPPPAAAYAHVPAMPSPGLMRPNPFAGDTYYDNAYTTTPRSVHEPYYYGMDTAETELPSPRRRSRRSVEERERPKSSTLAGLTGYGRGAHRVSEWRSFVEPGVPDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.08
4 0.09
5 0.11
6 0.12
7 0.12
8 0.14
9 0.16
10 0.16
11 0.17
12 0.16
13 0.16
14 0.15
15 0.16
16 0.13
17 0.1
18 0.1
19 0.12
20 0.15
21 0.15
22 0.18
23 0.18
24 0.2
25 0.21
26 0.2
27 0.18
28 0.16
29 0.19
30 0.18
31 0.18
32 0.17
33 0.16
34 0.16
35 0.15
36 0.14
37 0.11
38 0.11
39 0.11
40 0.11
41 0.11
42 0.16
43 0.17
44 0.19
45 0.19
46 0.19
47 0.17
48 0.2
49 0.2
50 0.15
51 0.13
52 0.11
53 0.1
54 0.1
55 0.11
56 0.07
57 0.08
58 0.1
59 0.13
60 0.17
61 0.23
62 0.29
63 0.37
64 0.41
65 0.49
66 0.55
67 0.63
68 0.69
69 0.75
70 0.78
71 0.78
72 0.83
73 0.82
74 0.77
75 0.68
76 0.59
77 0.5
78 0.41
79 0.38
80 0.3
81 0.25
82 0.22
83 0.22
84 0.2
85 0.19
86 0.18
87 0.13
88 0.12
89 0.13
90 0.13
91 0.12
92 0.15
93 0.21
94 0.25
95 0.31
96 0.33
97 0.34
98 0.36
99 0.36
100 0.34
101 0.32
102 0.29