Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7Q4C1

Protein Details
Accession A0A4Y7Q4C1    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-102GQPPAVRKPKAGKENKKAKNSDAHydrophilic
NLS Segment(s)
PositionSequence
20-33KTTKAKEDKPEKVK
77-98PKRGQPPAVRKPKAGKENKKAK
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF00505  HMG_box  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPRTATATTTKTATKRANAKTTKAKEDKPEKVKRAPSAYNIFMGIHLKKWREEHPGGSVKEGMTEVAAMWRDSPENPKRGQPPAVRKPKAGKENKKAKNSDAEEEEPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.53
4 0.61
5 0.6
6 0.65
7 0.68
8 0.69
9 0.72
10 0.68
11 0.65
12 0.65
13 0.7
14 0.73
15 0.72
16 0.76
17 0.71
18 0.73
19 0.75
20 0.71
21 0.69
22 0.62
23 0.58
24 0.55
25 0.5
26 0.43
27 0.37
28 0.31
29 0.24
30 0.24
31 0.17
32 0.15
33 0.17
34 0.17
35 0.19
36 0.22
37 0.25
38 0.3
39 0.31
40 0.29
41 0.33
42 0.39
43 0.37
44 0.35
45 0.32
46 0.24
47 0.23
48 0.21
49 0.14
50 0.07
51 0.06
52 0.05
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.09
59 0.1
60 0.18
61 0.22
62 0.27
63 0.28
64 0.34
65 0.38
66 0.43
67 0.5
68 0.5
69 0.55
70 0.6
71 0.7
72 0.66
73 0.67
74 0.7
75 0.72
76 0.74
77 0.74
78 0.74
79 0.74
80 0.82
81 0.86
82 0.87
83 0.81
84 0.76
85 0.75
86 0.7
87 0.66
88 0.62