Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PR42

Protein Details
Accession A0A4Y7PR42    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-49WDGNLPGRRRGPKSKKKRVLPGRLIPWBasic
NLS Segment(s)
PositionSequence
29-42GRRRGPKSKKKRVL
Subcellular Location(s) mito 10.5, plas 8, mito_nucl 8, nucl 4.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MCIYLIKRKPWTPQRVQEYADKWDGNLPGRRRGPKSKKKRVLPGRLIPWVGDFVQLDASIEMIYVTCRAAKKGGRPFSGSEKTLMISYHLIPVIIQLFLPDIGDFLVPIMQPYHHSANMLWDKFPELKPRSQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.73
4 0.7
5 0.63
6 0.59
7 0.54
8 0.44
9 0.36
10 0.35
11 0.35
12 0.33
13 0.37
14 0.35
15 0.38
16 0.45
17 0.52
18 0.54
19 0.62
20 0.67
21 0.71
22 0.79
23 0.81
24 0.84
25 0.86
26 0.9
27 0.9
28 0.89
29 0.88
30 0.85
31 0.8
32 0.74
33 0.66
34 0.55
35 0.45
36 0.36
37 0.27
38 0.2
39 0.13
40 0.09
41 0.1
42 0.09
43 0.09
44 0.07
45 0.06
46 0.05
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.04
53 0.06
54 0.06
55 0.07
56 0.11
57 0.13
58 0.21
59 0.29
60 0.36
61 0.36
62 0.39
63 0.41
64 0.46
65 0.48
66 0.41
67 0.33
68 0.27
69 0.25
70 0.24
71 0.21
72 0.15
73 0.12
74 0.11
75 0.13
76 0.12
77 0.11
78 0.1
79 0.11
80 0.11
81 0.09
82 0.08
83 0.06
84 0.06
85 0.06
86 0.07
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.1
99 0.16
100 0.2
101 0.19
102 0.21
103 0.2
104 0.29
105 0.38
106 0.37
107 0.32
108 0.28
109 0.31
110 0.35
111 0.38
112 0.39
113 0.35