Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PQX6

Protein Details
Accession A0A4Y7PQX6    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
104-134LNSRSPRSVPHHRRHYLRKRDSSRHRACLPCHydrophilic
NLS Segment(s)
PositionSequence
114-118HHRRH
121-121R
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012591  PRO8NT  
IPR027652  PRP8  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF08082  PRO8NT  
Amino Acid Sequences MSSFPPPPPGMPPPPPGMPMPPPGMPPFMGAGEPSRIPKEVLAQKSQKWIQMQNKRYGEKRKGGYIDMSKADLPPEHVRKIIKDHGDMSNRKFRNDKRVHLGALNSRSPRSVPHHRRHYLRKRDSSRHRACLPCSMEYDVACHASREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.42
4 0.4
5 0.36
6 0.35
7 0.35
8 0.31
9 0.31
10 0.31
11 0.31
12 0.26
13 0.24
14 0.21
15 0.17
16 0.16
17 0.14
18 0.14
19 0.15
20 0.15
21 0.16
22 0.16
23 0.16
24 0.16
25 0.17
26 0.23
27 0.28
28 0.31
29 0.36
30 0.38
31 0.39
32 0.47
33 0.48
34 0.44
35 0.39
36 0.43
37 0.46
38 0.52
39 0.56
40 0.57
41 0.62
42 0.61
43 0.64
44 0.65
45 0.62
46 0.59
47 0.56
48 0.52
49 0.48
50 0.46
51 0.45
52 0.39
53 0.36
54 0.29
55 0.28
56 0.22
57 0.2
58 0.19
59 0.14
60 0.15
61 0.18
62 0.21
63 0.2
64 0.22
65 0.23
66 0.24
67 0.29
68 0.31
69 0.27
70 0.25
71 0.27
72 0.31
73 0.38
74 0.39
75 0.38
76 0.41
77 0.39
78 0.39
79 0.43
80 0.4
81 0.45
82 0.49
83 0.51
84 0.49
85 0.53
86 0.53
87 0.49
88 0.48
89 0.44
90 0.42
91 0.41
92 0.35
93 0.31
94 0.3
95 0.28
96 0.3
97 0.31
98 0.37
99 0.42
100 0.51
101 0.61
102 0.67
103 0.75
104 0.81
105 0.84
106 0.84
107 0.84
108 0.85
109 0.84
110 0.88
111 0.9
112 0.91
113 0.89
114 0.87
115 0.84
116 0.8
117 0.73
118 0.72
119 0.65
120 0.58
121 0.52
122 0.47
123 0.41
124 0.35
125 0.35
126 0.27
127 0.27
128 0.23