Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R5XHW2

Protein Details
Accession A0A4R5XHW2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-120PLDLRPKKTRAIRRRLTPHEKSLKTVKQHKKDIHFPIRKYBasic
NLS Segment(s)
PositionSequence
84-113LRPKKTRAIRRRLTPHEKSLKTVKQHKKDI
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLHKQLSELKGELLALRVQKIAGGSASKLTKINTVRKSIARVLTVMNSKARQNLREYYKGKKYLPLDLRPKKTRAIRRRLTPHEKSLKTVKQHKKDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.55
4 0.6
5 0.57
6 0.55
7 0.54
8 0.58
9 0.56
10 0.5
11 0.44
12 0.35
13 0.29
14 0.25
15 0.22
16 0.14
17 0.13
18 0.12
19 0.12
20 0.12
21 0.11
22 0.11
23 0.11
24 0.1
25 0.09
26 0.09
27 0.08
28 0.12
29 0.13
30 0.13
31 0.14
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.23
47 0.23
48 0.2
49 0.18
50 0.16
51 0.16
52 0.21
53 0.22
54 0.21
55 0.23
56 0.29
57 0.32
58 0.4
59 0.42
60 0.43
61 0.49
62 0.53
63 0.5
64 0.49
65 0.46
66 0.46
67 0.51
68 0.53
69 0.56
70 0.59
71 0.67
72 0.66
73 0.66
74 0.64
75 0.66
76 0.67
77 0.67
78 0.69
79 0.69
80 0.74
81 0.82
82 0.85
83 0.86
84 0.81
85 0.81
86 0.81
87 0.74
88 0.69
89 0.68
90 0.65
91 0.64
92 0.68
93 0.69
94 0.68
95 0.76
96 0.79
97 0.78
98 0.81
99 0.83
100 0.83
101 0.81
102 0.74
103 0.74
104 0.75