Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QCF8

Protein Details
Accession A0A4Y7QCF8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-60QSCLHCHTNKRKCDRKRPCRRCIQLGMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSEASQNRIGNSNNFTDLGIRTDHRKSRRNRATQSCLHCHTNKRKCDRKRPCRRCIQLGMTGLCIYEVEDPDPWYYSLNGLLSCKFSRARAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.23
4 0.22
5 0.19
6 0.17
7 0.16
8 0.18
9 0.24
10 0.31
11 0.37
12 0.45
13 0.5
14 0.59
15 0.68
16 0.73
17 0.75
18 0.78
19 0.78
20 0.77
21 0.78
22 0.73
23 0.66
24 0.62
25 0.56
26 0.55
27 0.57
28 0.58
29 0.59
30 0.62
31 0.67
32 0.71
33 0.79
34 0.82
35 0.82
36 0.86
37 0.88
38 0.88
39 0.89
40 0.86
41 0.83
42 0.79
43 0.73
44 0.68
45 0.62
46 0.54
47 0.45
48 0.38
49 0.3
50 0.22
51 0.17
52 0.11
53 0.09
54 0.09
55 0.09
56 0.1
57 0.12
58 0.13
59 0.15
60 0.14
61 0.13
62 0.12
63 0.12
64 0.14
65 0.14
66 0.15
67 0.15
68 0.16
69 0.19
70 0.2
71 0.22
72 0.21
73 0.23