Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QL66

Protein Details
Accession A0A4Y7QL66    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
113-133STNFSSRRKPWKRQGEDSDSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046938  DNA_clamp_sf  
IPR003021  Rad1_Rec1_Rad17  
Gene Ontology GO:0005634  C:nucleus  
GO:0000077  P:DNA damage checkpoint signaling  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF02144  Rad1  
Amino Acid Sequences MSDGPQRLQPDVLKATVPDVRVFAMLLRSVSFSNRALMRINGGGLQINVEESPGRTLLASVYIDRDIFDGYHYAPEDPPEEDQDGVVSTDLEIPLNILIQCLNIFGSAVGSASTNFSSRRKPWKRQGEDSDSDGQGQNYGRGRMNGQDTNGRLDDYFSADRRKGTSMRMSYAGKGEPLTLFLAEDDSGPTTTCKIATFDGEPPLERPFDDEAMVLKCILKSSWFRDALSEVDPSCEKLTFIGNPIAEKSTGGRSKLQPPLRILADGTHGSSEMDFPSDKAVLETFECVEPVSFSYRFSHISPMLRALQGSSKTSLRIDDEGLLCLQFLTESQSPRSGIRRTVSSIVDFKCPALDEDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.29
4 0.29
5 0.23
6 0.2
7 0.2
8 0.19
9 0.19
10 0.16
11 0.16
12 0.16
13 0.15
14 0.15
15 0.15
16 0.16
17 0.18
18 0.19
19 0.17
20 0.21
21 0.22
22 0.23
23 0.24
24 0.24
25 0.25
26 0.23
27 0.23
28 0.19
29 0.18
30 0.17
31 0.15
32 0.15
33 0.11
34 0.11
35 0.1
36 0.09
37 0.09
38 0.08
39 0.11
40 0.1
41 0.1
42 0.09
43 0.1
44 0.09
45 0.13
46 0.13
47 0.12
48 0.14
49 0.15
50 0.15
51 0.14
52 0.15
53 0.11
54 0.1
55 0.1
56 0.1
57 0.1
58 0.13
59 0.14
60 0.14
61 0.14
62 0.16
63 0.17
64 0.16
65 0.17
66 0.17
67 0.17
68 0.16
69 0.16
70 0.14
71 0.13
72 0.12
73 0.1
74 0.07
75 0.06
76 0.08
77 0.08
78 0.08
79 0.07
80 0.07
81 0.07
82 0.08
83 0.08
84 0.06
85 0.06
86 0.06
87 0.07
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.07
101 0.08
102 0.1
103 0.13
104 0.19
105 0.25
106 0.36
107 0.44
108 0.53
109 0.62
110 0.71
111 0.77
112 0.8
113 0.83
114 0.8
115 0.74
116 0.69
117 0.63
118 0.52
119 0.45
120 0.36
121 0.27
122 0.21
123 0.18
124 0.18
125 0.15
126 0.17
127 0.17
128 0.17
129 0.18
130 0.2
131 0.25
132 0.22
133 0.22
134 0.24
135 0.24
136 0.27
137 0.26
138 0.22
139 0.17
140 0.16
141 0.15
142 0.15
143 0.16
144 0.14
145 0.18
146 0.18
147 0.19
148 0.2
149 0.22
150 0.19
151 0.21
152 0.27
153 0.26
154 0.28
155 0.31
156 0.3
157 0.28
158 0.28
159 0.24
160 0.17
161 0.15
162 0.13
163 0.1
164 0.1
165 0.09
166 0.07
167 0.07
168 0.06
169 0.07
170 0.06
171 0.06
172 0.05
173 0.05
174 0.06
175 0.06
176 0.06
177 0.06
178 0.07
179 0.07
180 0.07
181 0.08
182 0.09
183 0.1
184 0.12
185 0.14
186 0.17
187 0.17
188 0.17
189 0.16
190 0.17
191 0.16
192 0.13
193 0.14
194 0.13
195 0.13
196 0.13
197 0.12
198 0.12
199 0.14
200 0.14
201 0.11
202 0.09
203 0.09
204 0.09
205 0.09
206 0.1
207 0.13
208 0.17
209 0.25
210 0.26
211 0.26
212 0.27
213 0.29
214 0.27
215 0.25
216 0.22
217 0.14
218 0.15
219 0.15
220 0.15
221 0.14
222 0.13
223 0.11
224 0.1
225 0.13
226 0.12
227 0.14
228 0.17
229 0.16
230 0.17
231 0.18
232 0.18
233 0.16
234 0.15
235 0.14
236 0.18
237 0.21
238 0.23
239 0.27
240 0.29
241 0.38
242 0.46
243 0.5
244 0.47
245 0.47
246 0.5
247 0.46
248 0.43
249 0.35
250 0.28
251 0.26
252 0.22
253 0.2
254 0.15
255 0.13
256 0.13
257 0.12
258 0.12
259 0.08
260 0.09
261 0.08
262 0.08
263 0.11
264 0.11
265 0.11
266 0.11
267 0.11
268 0.11
269 0.12
270 0.13
271 0.12
272 0.11
273 0.11
274 0.11
275 0.1
276 0.1
277 0.11
278 0.14
279 0.13
280 0.14
281 0.17
282 0.19
283 0.22
284 0.22
285 0.28
286 0.27
287 0.32
288 0.32
289 0.34
290 0.35
291 0.32
292 0.31
293 0.26
294 0.28
295 0.27
296 0.28
297 0.26
298 0.25
299 0.26
300 0.27
301 0.28
302 0.25
303 0.24
304 0.24
305 0.26
306 0.25
307 0.25
308 0.25
309 0.22
310 0.17
311 0.15
312 0.13
313 0.07
314 0.06
315 0.12
316 0.15
317 0.18
318 0.21
319 0.25
320 0.27
321 0.31
322 0.37
323 0.35
324 0.37
325 0.4
326 0.42
327 0.44
328 0.48
329 0.47
330 0.45
331 0.48
332 0.44
333 0.44
334 0.4
335 0.35
336 0.32
337 0.3