Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PP98

Protein Details
Accession A0A4Y7PP98    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
90-112EDPQKFWHPEKPKKTVRGRGPAVBasic
NLS Segment(s)
PositionSequence
98-124PEKPKKTVRGRGPAVQNGKRIRSRRHQ
Subcellular Location(s) mito 24, cyto_mito 13.333, mito_nucl 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MSLLRRLCTCLPPLARSFQTHVPKPPPPTSRIQSAQGFLTAIGRSAESKLKVEDWEELWKLDGKGMKKMGLTIQDRRYILWAMEKFRQGEDPQKFWHPEKPKKTVRGRGPAVQNGKRIRSRRHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.41
4 0.42
5 0.43
6 0.47
7 0.48
8 0.52
9 0.52
10 0.55
11 0.58
12 0.62
13 0.58
14 0.54
15 0.57
16 0.54
17 0.55
18 0.53
19 0.52
20 0.46
21 0.43
22 0.39
23 0.32
24 0.28
25 0.2
26 0.18
27 0.12
28 0.1
29 0.09
30 0.08
31 0.08
32 0.1
33 0.13
34 0.12
35 0.14
36 0.14
37 0.15
38 0.15
39 0.16
40 0.16
41 0.15
42 0.18
43 0.17
44 0.16
45 0.16
46 0.17
47 0.16
48 0.16
49 0.16
50 0.13
51 0.17
52 0.18
53 0.19
54 0.17
55 0.18
56 0.19
57 0.23
58 0.26
59 0.28
60 0.31
61 0.35
62 0.35
63 0.34
64 0.34
65 0.27
66 0.24
67 0.25
68 0.24
69 0.23
70 0.27
71 0.29
72 0.28
73 0.28
74 0.31
75 0.25
76 0.32
77 0.33
78 0.33
79 0.34
80 0.39
81 0.42
82 0.4
83 0.48
84 0.49
85 0.54
86 0.58
87 0.65
88 0.68
89 0.74
90 0.81
91 0.82
92 0.81
93 0.82
94 0.79
95 0.77
96 0.77
97 0.75
98 0.75
99 0.71
100 0.69
101 0.65
102 0.67
103 0.68
104 0.67