Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R5XDV0

Protein Details
Accession A0A4R5XDV0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-36ASKSSGGKAAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
10-30KSSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAAAAASKSSGGKAAKKKKWSKGKVKDKAQHAVTLDKPTYDRILKEVPTFRFISQSILIERLKINGSLARVAIRHLAKEGQIKQIVHHSAQLIYTRATAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.38
3 0.47
4 0.51
5 0.61
6 0.7
7 0.74
8 0.82
9 0.85
10 0.86
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.84
17 0.81
18 0.72
19 0.65
20 0.55
21 0.5
22 0.42
23 0.4
24 0.34
25 0.26
26 0.25
27 0.22
28 0.24
29 0.2
30 0.18
31 0.16
32 0.2
33 0.2
34 0.24
35 0.28
36 0.25
37 0.27
38 0.28
39 0.25
40 0.24
41 0.23
42 0.22
43 0.18
44 0.18
45 0.15
46 0.18
47 0.17
48 0.16
49 0.16
50 0.14
51 0.14
52 0.12
53 0.13
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.12
60 0.13
61 0.18
62 0.17
63 0.16
64 0.17
65 0.18
66 0.2
67 0.28
68 0.29
69 0.31
70 0.35
71 0.35
72 0.35
73 0.41
74 0.41
75 0.34
76 0.35
77 0.28
78 0.25
79 0.27
80 0.28
81 0.22
82 0.2
83 0.19