Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PW32

Protein Details
Accession A0A4Y7PW32    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-43DSGVKKAKLKHEPPKRPKSLHBasic
NLS Segment(s)
PositionSequence
27-40KKAKLKHEPPKRPK
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MYSFGCVCLEVFSRKPPYAELDDSGVKKAKLKHEPPKRPKSLHMDECLWDLTCKFFRFSPATRPTAAAASREIEHIIKWYNNLHTHPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.34
5 0.35
6 0.36
7 0.31
8 0.29
9 0.32
10 0.32
11 0.33
12 0.29
13 0.23
14 0.25
15 0.28
16 0.33
17 0.38
18 0.46
19 0.54
20 0.62
21 0.73
22 0.8
23 0.85
24 0.83
25 0.76
26 0.74
27 0.73
28 0.71
29 0.66
30 0.59
31 0.51
32 0.44
33 0.43
34 0.37
35 0.28
36 0.19
37 0.13
38 0.12
39 0.14
40 0.14
41 0.15
42 0.14
43 0.19
44 0.24
45 0.27
46 0.34
47 0.37
48 0.39
49 0.38
50 0.39
51 0.36
52 0.35
53 0.34
54 0.25
55 0.2
56 0.2
57 0.19
58 0.19
59 0.19
60 0.15
61 0.14
62 0.16
63 0.18
64 0.17
65 0.19
66 0.22
67 0.27
68 0.32