Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7QJD7

Protein Details
Accession A0A4Y7QJD7    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-119PSKPSEPTEKRKRGRPPKPKPEGEELTPKRPRGRPPKHPRPEKDKEDDDKBasic
NLS Segment(s)
PositionSequence
68-114PGPSKPSEPTEKRKRGRPPKPKPEGEELTPKRPRGRPPKHPRPEKDK
128-140PPKKKRGRPPKAA
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSASPANDDLHDHHKPSEHKPDDAPAPETTAQGMPPSDLRSYRDPLTNTTLQTIPHSKNKKAGDSDAPGPSKPSEPTEKRKRGRPPKPKPEGEELTPKRPRGRPPKHPRPEKDKEDDDKDASGDTDEPPKKKRGRPPKAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.42
4 0.49
5 0.46
6 0.45
7 0.46
8 0.5
9 0.49
10 0.48
11 0.44
12 0.33
13 0.34
14 0.32
15 0.3
16 0.26
17 0.2
18 0.17
19 0.16
20 0.15
21 0.11
22 0.12
23 0.14
24 0.14
25 0.15
26 0.19
27 0.22
28 0.26
29 0.27
30 0.3
31 0.29
32 0.31
33 0.36
34 0.35
35 0.31
36 0.29
37 0.28
38 0.23
39 0.26
40 0.27
41 0.24
42 0.3
43 0.34
44 0.33
45 0.39
46 0.42
47 0.43
48 0.41
49 0.41
50 0.38
51 0.36
52 0.39
53 0.36
54 0.34
55 0.29
56 0.28
57 0.25
58 0.21
59 0.18
60 0.18
61 0.22
62 0.27
63 0.37
64 0.46
65 0.55
66 0.58
67 0.65
68 0.72
69 0.75
70 0.8
71 0.81
72 0.82
73 0.83
74 0.89
75 0.87
76 0.81
77 0.78
78 0.72
79 0.64
80 0.64
81 0.57
82 0.57
83 0.56
84 0.54
85 0.52
86 0.53
87 0.59
88 0.59
89 0.65
90 0.67
91 0.73
92 0.82
93 0.86
94 0.91
95 0.9
96 0.88
97 0.88
98 0.85
99 0.83
100 0.81
101 0.77
102 0.74
103 0.71
104 0.63
105 0.54
106 0.46
107 0.38
108 0.29
109 0.23
110 0.17
111 0.14
112 0.21
113 0.26
114 0.29
115 0.33
116 0.41
117 0.49
118 0.56
119 0.65
120 0.67
121 0.73