Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7Q3K9

Protein Details
Accession A0A4Y7Q3K9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-40APRHLNRKASKLSKPRPTKPNANSKGHydrophilic
NLS Segment(s)
PositionSequence
21-31RKASKLSKPRP
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MNVRRLSVSISGTQAPRHLNRKASKLSKPRPTKPNANSKGWQDITTASSSTTTVKPESSSDASVPPSSPSSKPKPLGRKMTLVWKSLTGFTRTRARIGKPQRQSVLMNRFEIIVPLPRGRHGDAQFWRKPDSISRRSVISIRPRELAERRLSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.34
4 0.37
5 0.39
6 0.44
7 0.49
8 0.56
9 0.62
10 0.63
11 0.66
12 0.71
13 0.76
14 0.77
15 0.81
16 0.82
17 0.82
18 0.82
19 0.83
20 0.8
21 0.82
22 0.78
23 0.75
24 0.7
25 0.64
26 0.66
27 0.57
28 0.49
29 0.39
30 0.34
31 0.29
32 0.26
33 0.22
34 0.13
35 0.13
36 0.12
37 0.14
38 0.13
39 0.13
40 0.13
41 0.13
42 0.14
43 0.14
44 0.19
45 0.18
46 0.18
47 0.17
48 0.18
49 0.19
50 0.18
51 0.18
52 0.14
53 0.14
54 0.15
55 0.16
56 0.2
57 0.26
58 0.31
59 0.36
60 0.41
61 0.49
62 0.54
63 0.61
64 0.58
65 0.55
66 0.5
67 0.56
68 0.52
69 0.45
70 0.38
71 0.3
72 0.29
73 0.28
74 0.28
75 0.22
76 0.19
77 0.21
78 0.29
79 0.28
80 0.31
81 0.31
82 0.33
83 0.39
84 0.48
85 0.54
86 0.52
87 0.58
88 0.56
89 0.56
90 0.55
91 0.55
92 0.55
93 0.49
94 0.43
95 0.36
96 0.35
97 0.31
98 0.28
99 0.21
100 0.17
101 0.17
102 0.18
103 0.19
104 0.2
105 0.24
106 0.26
107 0.33
108 0.3
109 0.36
110 0.41
111 0.49
112 0.51
113 0.5
114 0.51
115 0.44
116 0.44
117 0.44
118 0.47
119 0.45
120 0.48
121 0.47
122 0.46
123 0.48
124 0.49
125 0.48
126 0.48
127 0.5
128 0.47
129 0.48
130 0.47
131 0.52
132 0.54
133 0.54
134 0.53