Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7QB58

Protein Details
Accession A0A4Y7QB58    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
311-336ILASIQQQQKKRNKVWKKVAKVFSGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, cyto 6.5, cysk 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002151  Kinesin_light  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0005871  C:kinesin complex  
GO:0005874  C:microtubule  
Pfam View protein in Pfam  
PF13374  TPR_10  
PF13424  TPR_12  
Amino Acid Sequences MNETMEDLGAEHPDTLTSMNNLAVTYLDQGKLKEAEELKIQVLEIRKRILGAEHPDTLTSMSNLASTYLDQGKLKEAEELKIQVKRILGAEHPDTLTSMNNFARSYSAEGKSEEAEKLEIQVLKIRKRILGAEHPVTLTSMSNLASTYLDQGKLKEAEELKIQVLEIRKRILGAEHPDTLISMGNLARSYSAQGKSEEAEKLEIQVLEIRKRTLGAEHPDTLTGMSNLAVTYSDQGKLKEAEELKIQVLEIRKKILGAEHPDTLTSMSNLAVTYSDQGKLKEAEELQIQVVEISTRVLGAEHPHTLIRMDILASIQQQQKKRNKVWKKVAKVFSGGMSLSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.11
5 0.11
6 0.12
7 0.13
8 0.13
9 0.12
10 0.12
11 0.11
12 0.13
13 0.15
14 0.15
15 0.16
16 0.17
17 0.21
18 0.22
19 0.21
20 0.25
21 0.24
22 0.25
23 0.28
24 0.3
25 0.27
26 0.25
27 0.25
28 0.22
29 0.27
30 0.29
31 0.28
32 0.29
33 0.28
34 0.28
35 0.29
36 0.28
37 0.29
38 0.31
39 0.32
40 0.33
41 0.32
42 0.32
43 0.32
44 0.3
45 0.23
46 0.16
47 0.12
48 0.09
49 0.1
50 0.09
51 0.1
52 0.09
53 0.09
54 0.12
55 0.14
56 0.16
57 0.16
58 0.17
59 0.21
60 0.22
61 0.22
62 0.25
63 0.24
64 0.25
65 0.29
66 0.32
67 0.31
68 0.33
69 0.33
70 0.29
71 0.28
72 0.26
73 0.23
74 0.22
75 0.19
76 0.21
77 0.22
78 0.22
79 0.22
80 0.21
81 0.2
82 0.19
83 0.19
84 0.14
85 0.16
86 0.14
87 0.16
88 0.16
89 0.15
90 0.16
91 0.15
92 0.2
93 0.22
94 0.23
95 0.23
96 0.24
97 0.25
98 0.25
99 0.25
100 0.2
101 0.15
102 0.13
103 0.12
104 0.12
105 0.14
106 0.14
107 0.12
108 0.17
109 0.21
110 0.24
111 0.28
112 0.28
113 0.26
114 0.26
115 0.28
116 0.29
117 0.32
118 0.34
119 0.33
120 0.33
121 0.31
122 0.3
123 0.28
124 0.23
125 0.14
126 0.09
127 0.07
128 0.07
129 0.07
130 0.07
131 0.08
132 0.08
133 0.08
134 0.12
135 0.14
136 0.16
137 0.16
138 0.17
139 0.21
140 0.22
141 0.22
142 0.25
143 0.24
144 0.25
145 0.29
146 0.31
147 0.27
148 0.25
149 0.25
150 0.22
151 0.27
152 0.29
153 0.28
154 0.29
155 0.28
156 0.28
157 0.29
158 0.28
159 0.29
160 0.31
161 0.32
162 0.3
163 0.3
164 0.29
165 0.28
166 0.25
167 0.17
168 0.1
169 0.06
170 0.05
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.08
177 0.12
178 0.14
179 0.15
180 0.16
181 0.17
182 0.17
183 0.2
184 0.19
185 0.14
186 0.15
187 0.13
188 0.14
189 0.14
190 0.13
191 0.11
192 0.14
193 0.16
194 0.17
195 0.19
196 0.18
197 0.16
198 0.17
199 0.17
200 0.16
201 0.2
202 0.23
203 0.26
204 0.28
205 0.28
206 0.27
207 0.27
208 0.24
209 0.19
210 0.12
211 0.08
212 0.07
213 0.06
214 0.06
215 0.06
216 0.06
217 0.05
218 0.07
219 0.08
220 0.11
221 0.12
222 0.13
223 0.15
224 0.16
225 0.16
226 0.2
227 0.21
228 0.21
229 0.25
230 0.27
231 0.25
232 0.25
233 0.24
234 0.22
235 0.26
236 0.28
237 0.25
238 0.26
239 0.25
240 0.24
241 0.25
242 0.26
243 0.26
244 0.29
245 0.31
246 0.3
247 0.3
248 0.3
249 0.3
250 0.27
251 0.21
252 0.14
253 0.11
254 0.09
255 0.09
256 0.09
257 0.09
258 0.08
259 0.08
260 0.09
261 0.1
262 0.12
263 0.13
264 0.13
265 0.16
266 0.16
267 0.16
268 0.2
269 0.19
270 0.2
271 0.21
272 0.22
273 0.2
274 0.19
275 0.18
276 0.13
277 0.12
278 0.09
279 0.07
280 0.07
281 0.06
282 0.05
283 0.06
284 0.06
285 0.07
286 0.11
287 0.15
288 0.16
289 0.17
290 0.18
291 0.18
292 0.18
293 0.18
294 0.14
295 0.11
296 0.1
297 0.1
298 0.1
299 0.12
300 0.13
301 0.19
302 0.24
303 0.29
304 0.34
305 0.44
306 0.52
307 0.6
308 0.68
309 0.73
310 0.78
311 0.83
312 0.89
313 0.89
314 0.91
315 0.91
316 0.89
317 0.83
318 0.77
319 0.68
320 0.59
321 0.52
322 0.41