Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QH46

Protein Details
Accession A0A4Y7QH46    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPGPCSAKRKKKQEAMKAKLKAVHydrophilic
NLS Segment(s)
PositionSequence
8-21KRKKKQEAMKAKLK
Subcellular Location(s) cyto 14cyto_nucl 14, nucl 10
Family & Domain DBs
Amino Acid Sequences MPGPCSAKRKKKQEAMKAKLKAVRVGGHQEVEKLDNVDVSLQNRAELTDVQKPPRHNYNGDTDASAVEKLDAVPPDASNLKPFIEDPGNGPRVKDTRAFLRSFFALPPSLDDPTCAYFARDGVLAALLELLPEEIAHVCIFPLQTRMTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.87
3 0.87
4 0.82
5 0.78
6 0.73
7 0.65
8 0.58
9 0.51
10 0.46
11 0.4
12 0.42
13 0.38
14 0.37
15 0.35
16 0.31
17 0.29
18 0.26
19 0.23
20 0.18
21 0.15
22 0.12
23 0.12
24 0.13
25 0.13
26 0.13
27 0.15
28 0.14
29 0.14
30 0.14
31 0.14
32 0.13
33 0.13
34 0.15
35 0.2
36 0.23
37 0.27
38 0.31
39 0.33
40 0.37
41 0.44
42 0.44
43 0.37
44 0.37
45 0.41
46 0.41
47 0.39
48 0.35
49 0.26
50 0.23
51 0.21
52 0.18
53 0.1
54 0.06
55 0.05
56 0.05
57 0.07
58 0.07
59 0.07
60 0.08
61 0.08
62 0.1
63 0.11
64 0.1
65 0.1
66 0.1
67 0.09
68 0.09
69 0.1
70 0.11
71 0.12
72 0.12
73 0.14
74 0.2
75 0.23
76 0.23
77 0.23
78 0.23
79 0.23
80 0.25
81 0.26
82 0.21
83 0.26
84 0.31
85 0.32
86 0.29
87 0.3
88 0.29
89 0.27
90 0.25
91 0.19
92 0.16
93 0.14
94 0.18
95 0.18
96 0.18
97 0.17
98 0.17
99 0.18
100 0.18
101 0.2
102 0.16
103 0.14
104 0.13
105 0.14
106 0.14
107 0.12
108 0.1
109 0.08
110 0.09
111 0.08
112 0.07
113 0.07
114 0.06
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.05
121 0.05
122 0.06
123 0.07
124 0.07
125 0.06
126 0.08
127 0.1
128 0.1
129 0.13