Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PII2

Protein Details
Accession A0A4Y7PII2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-44THYSPTSIARRKRRIRKTDRAHGRWWHydrophilic
NLS Segment(s)
PositionSequence
28-38RRKRRIRKTDR
Subcellular Location(s) plas 12, mito 5, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MPVNYWSECHCVKWLASGTHYSPTSIARRKRRIRKTDRAHGRWWEDSTEDLSWSSPPPVFMGWLIVSFGMFVPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.28
4 0.3
5 0.29
6 0.32
7 0.32
8 0.26
9 0.22
10 0.23
11 0.29
12 0.33
13 0.39
14 0.44
15 0.54
16 0.63
17 0.73
18 0.79
19 0.83
20 0.85
21 0.87
22 0.87
23 0.87
24 0.88
25 0.82
26 0.76
27 0.71
28 0.66
29 0.58
30 0.5
31 0.41
32 0.31
33 0.28
34 0.26
35 0.2
36 0.16
37 0.13
38 0.12
39 0.12
40 0.12
41 0.13
42 0.11
43 0.11
44 0.12
45 0.12
46 0.12
47 0.12
48 0.14
49 0.13
50 0.13
51 0.13
52 0.11
53 0.11
54 0.1