Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R5XFB8

Protein Details
Accession A0A4R5XFB8    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-33HTNHNQSKKAHKNGIKRPSKNRTRSLRHydrophilic
NLS Segment(s)
PositionSequence
14-43KKAHKNGIKRPSKNRTRSLRGVDAKFRRNA
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQSKKAHKNGIKRPSKNRTRSLRGVDAKFRRNARFALAGSQKARLEQRLAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.78
4 0.74
5 0.75
6 0.76
7 0.82
8 0.81
9 0.78
10 0.8
11 0.81
12 0.83
13 0.81
14 0.8
15 0.79
16 0.76
17 0.76
18 0.72
19 0.7
20 0.67
21 0.62
22 0.61
23 0.59
24 0.56
25 0.55
26 0.55
27 0.49
28 0.45
29 0.43
30 0.38
31 0.37
32 0.32
33 0.36
34 0.35
35 0.37
36 0.36
37 0.4
38 0.36
39 0.35
40 0.38
41 0.32
42 0.31
43 0.28