Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N6Z5

Protein Details
Accession G9N6Z5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
166-185DKREELRKAMRKERRATIKEBasic
NLS Segment(s)
PositionSequence
110-122SKKQRKLAAKRQK
172-179RKAMRKER
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFCTRCLRATVARRQLPFSRQFSSSLRFYSAEPQLSTPVVDAGEAAKPTPTSRSICPEGTVLNGLNYTKGGQDPVAMKDEDYPEWLWSCLDVMKKADAEDDNLGDEFSKSKKQRKLAAKRQKALEAKLLAEGNLEALAPKVPLQKQSINLPGQQNGSVLDNIAAADKREELRKAMRKERRATIKESNYLKSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.63
4 0.63
5 0.57
6 0.51
7 0.46
8 0.49
9 0.47
10 0.46
11 0.42
12 0.35
13 0.33
14 0.3
15 0.3
16 0.33
17 0.34
18 0.33
19 0.31
20 0.3
21 0.29
22 0.28
23 0.27
24 0.2
25 0.15
26 0.11
27 0.1
28 0.09
29 0.08
30 0.1
31 0.1
32 0.09
33 0.09
34 0.1
35 0.11
36 0.14
37 0.16
38 0.17
39 0.2
40 0.27
41 0.3
42 0.3
43 0.31
44 0.29
45 0.25
46 0.23
47 0.22
48 0.15
49 0.12
50 0.12
51 0.1
52 0.1
53 0.09
54 0.09
55 0.07
56 0.07
57 0.08
58 0.07
59 0.1
60 0.11
61 0.13
62 0.15
63 0.14
64 0.14
65 0.16
66 0.18
67 0.15
68 0.15
69 0.14
70 0.12
71 0.13
72 0.13
73 0.1
74 0.08
75 0.08
76 0.08
77 0.09
78 0.09
79 0.1
80 0.11
81 0.11
82 0.11
83 0.13
84 0.11
85 0.12
86 0.11
87 0.11
88 0.1
89 0.1
90 0.1
91 0.08
92 0.08
93 0.07
94 0.07
95 0.15
96 0.18
97 0.27
98 0.33
99 0.39
100 0.48
101 0.57
102 0.67
103 0.7
104 0.78
105 0.79
106 0.79
107 0.76
108 0.75
109 0.68
110 0.59
111 0.55
112 0.46
113 0.37
114 0.35
115 0.31
116 0.23
117 0.2
118 0.17
119 0.1
120 0.08
121 0.08
122 0.04
123 0.05
124 0.05
125 0.05
126 0.07
127 0.12
128 0.14
129 0.18
130 0.23
131 0.27
132 0.3
133 0.36
134 0.42
135 0.39
136 0.42
137 0.41
138 0.39
139 0.36
140 0.34
141 0.28
142 0.22
143 0.22
144 0.17
145 0.14
146 0.11
147 0.1
148 0.09
149 0.11
150 0.1
151 0.09
152 0.1
153 0.12
154 0.14
155 0.19
156 0.21
157 0.23
158 0.33
159 0.41
160 0.49
161 0.57
162 0.64
163 0.69
164 0.74
165 0.8
166 0.81
167 0.76
168 0.75
169 0.75
170 0.75
171 0.74
172 0.72