Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PEW7

Protein Details
Accession A0A4Y7PEW7    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-35LNEAQRRLGKRLRRLRRLSKPLVLEHydrophilic
NLS Segment(s)
PositionSequence
16-28RRLGKRLRRLRRL
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF12937  F-box-like  
Amino Acid Sequences MEGARVCMKALNEAQRRLGKRLRRLRRLSKPLVLEDGIKRLPDDVLAIIFEMGCHFNEDDLYQFAVCVSHVSHRFRGVALATPLLWTTIQDSYGENEIREFISRSGQLDLHIKRPNNSEIESLLQVLRDSESSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.56
4 0.56
5 0.58
6 0.56
7 0.6
8 0.68
9 0.71
10 0.74
11 0.8
12 0.84
13 0.88
14 0.89
15 0.86
16 0.82
17 0.75
18 0.67
19 0.62
20 0.52
21 0.45
22 0.36
23 0.35
24 0.29
25 0.24
26 0.21
27 0.18
28 0.17
29 0.13
30 0.13
31 0.08
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.08
48 0.08
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.09
57 0.14
58 0.17
59 0.18
60 0.2
61 0.2
62 0.2
63 0.21
64 0.17
65 0.16
66 0.14
67 0.13
68 0.12
69 0.12
70 0.12
71 0.11
72 0.1
73 0.06
74 0.08
75 0.08
76 0.09
77 0.09
78 0.1
79 0.11
80 0.16
81 0.16
82 0.14
83 0.13
84 0.13
85 0.14
86 0.15
87 0.14
88 0.1
89 0.15
90 0.16
91 0.17
92 0.19
93 0.18
94 0.19
95 0.26
96 0.27
97 0.3
98 0.35
99 0.35
100 0.37
101 0.41
102 0.44
103 0.4
104 0.4
105 0.35
106 0.32
107 0.34
108 0.32
109 0.28
110 0.23
111 0.2
112 0.18
113 0.16
114 0.15