Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PH80

Protein Details
Accession A0A4Y7PH80    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-111LSTLHRRREYKNKGDKRVAKBasic
NLS Segment(s)
PositionSequence
99-111REYKNKGDKRVAK
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MNSVNASTGFSPFQLRMGRSPRIIPPLVPNSLTADISASSEGGAAKAIIDQIERDVAEAKDNLFMAKVSQASAANVHREKDDFFDIGDKVMLSTLHRRREYKNKGDKRVAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.29
4 0.34
5 0.38
6 0.37
7 0.41
8 0.4
9 0.42
10 0.41
11 0.35
12 0.37
13 0.38
14 0.38
15 0.35
16 0.31
17 0.28
18 0.29
19 0.28
20 0.2
21 0.15
22 0.13
23 0.13
24 0.12
25 0.07
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.09
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.07
51 0.07
52 0.06
53 0.08
54 0.08
55 0.07
56 0.09
57 0.09
58 0.1
59 0.13
60 0.14
61 0.19
62 0.2
63 0.2
64 0.19
65 0.2
66 0.2
67 0.21
68 0.22
69 0.16
70 0.15
71 0.18
72 0.17
73 0.16
74 0.16
75 0.12
76 0.09
77 0.1
78 0.1
79 0.1
80 0.2
81 0.26
82 0.35
83 0.41
84 0.44
85 0.51
86 0.62
87 0.69
88 0.7
89 0.74
90 0.75
91 0.8