Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9N7K0

Protein Details
Accession G9N7K0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-43LCSFICRHRAQCHQRRRRGVPQDEESKAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
IPR008509  MOT2/MFSD5  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0015098  F:molybdate ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF05631  MFS_5  
Amino Acid Sequences MDFYQVNLVVLVVVNLCSFICRHRAQCHQRRRRGVPQDEESKAAATKFQRQFLFVYTLVVAADWLQGPYTYAIYKYEKQLEEHTVALLYASGFVSGAVSATFAGQLADCYGRRAACIAYCICYGITCLTMLSQNLNILYLGRFFGGIATTLLFSVFEAWMIAEYNLLRVDESIVSLSQVFANMTTTSSITAIFSGVLGNCLVQWFDSRLGPFLASLGCCIGASMLILATWRENYGSIETSKETPDAWKLKHRMLAALTSPKVMAVNFVSCCFEGPMYLFVFFWSAALKGVRVKSGHQDELPFGLIFSSFMCAMMAGSNITTVRNSLYSNDNTLNTLMFVFAITSGGFAVSTVVDHEYVLFWAFCVIEACVGAYFPKMALVKSRVVDDYARGGVYSALRLPLNVFVVVAHSLDRDGDEHRNSVFLFCAGLLLVAFLVISGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.07
5 0.08
6 0.1
7 0.18
8 0.22
9 0.29
10 0.36
11 0.47
12 0.58
13 0.67
14 0.76
15 0.79
16 0.84
17 0.88
18 0.89
19 0.89
20 0.89
21 0.88
22 0.86
23 0.84
24 0.83
25 0.75
26 0.69
27 0.59
28 0.5
29 0.42
30 0.33
31 0.29
32 0.24
33 0.32
34 0.35
35 0.41
36 0.4
37 0.41
38 0.42
39 0.41
40 0.42
41 0.32
42 0.29
43 0.22
44 0.21
45 0.19
46 0.17
47 0.13
48 0.08
49 0.09
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.1
56 0.11
57 0.1
58 0.1
59 0.15
60 0.2
61 0.23
62 0.28
63 0.35
64 0.35
65 0.37
66 0.42
67 0.43
68 0.4
69 0.37
70 0.31
71 0.23
72 0.21
73 0.18
74 0.13
75 0.08
76 0.07
77 0.06
78 0.06
79 0.05
80 0.05
81 0.06
82 0.05
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.04
90 0.05
91 0.04
92 0.05
93 0.06
94 0.09
95 0.09
96 0.11
97 0.14
98 0.13
99 0.14
100 0.15
101 0.14
102 0.13
103 0.17
104 0.15
105 0.16
106 0.16
107 0.17
108 0.15
109 0.14
110 0.14
111 0.1
112 0.1
113 0.07
114 0.07
115 0.07
116 0.09
117 0.09
118 0.1
119 0.1
120 0.1
121 0.1
122 0.1
123 0.1
124 0.09
125 0.09
126 0.08
127 0.08
128 0.07
129 0.07
130 0.06
131 0.07
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.05
140 0.05
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.05
150 0.05
151 0.07
152 0.07
153 0.07
154 0.07
155 0.06
156 0.08
157 0.07
158 0.08
159 0.07
160 0.07
161 0.07
162 0.07
163 0.07
164 0.06
165 0.06
166 0.05
167 0.05
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.06
177 0.06
178 0.06
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.04
187 0.05
188 0.04
189 0.04
190 0.05
191 0.06
192 0.07
193 0.09
194 0.09
195 0.1
196 0.1
197 0.1
198 0.09
199 0.08
200 0.08
201 0.06
202 0.06
203 0.05
204 0.05
205 0.05
206 0.05
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.02
213 0.03
214 0.03
215 0.03
216 0.04
217 0.04
218 0.04
219 0.05
220 0.06
221 0.08
222 0.09
223 0.09
224 0.11
225 0.12
226 0.13
227 0.13
228 0.12
229 0.11
230 0.11
231 0.17
232 0.2
233 0.21
234 0.28
235 0.3
236 0.33
237 0.37
238 0.36
239 0.32
240 0.29
241 0.3
242 0.25
243 0.28
244 0.25
245 0.21
246 0.21
247 0.18
248 0.17
249 0.14
250 0.13
251 0.08
252 0.11
253 0.11
254 0.12
255 0.13
256 0.13
257 0.14
258 0.12
259 0.11
260 0.08
261 0.08
262 0.1
263 0.1
264 0.1
265 0.09
266 0.09
267 0.1
268 0.09
269 0.08
270 0.06
271 0.06
272 0.07
273 0.07
274 0.08
275 0.11
276 0.13
277 0.16
278 0.16
279 0.18
280 0.25
281 0.3
282 0.32
283 0.3
284 0.3
285 0.28
286 0.29
287 0.29
288 0.2
289 0.14
290 0.11
291 0.1
292 0.09
293 0.08
294 0.07
295 0.05
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.06
302 0.05
303 0.05
304 0.06
305 0.06
306 0.07
307 0.07
308 0.07
309 0.08
310 0.09
311 0.1
312 0.11
313 0.17
314 0.18
315 0.22
316 0.24
317 0.23
318 0.23
319 0.23
320 0.21
321 0.15
322 0.14
323 0.1
324 0.07
325 0.06
326 0.05
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.05
333 0.05
334 0.04
335 0.05
336 0.04
337 0.04
338 0.05
339 0.07
340 0.07
341 0.07
342 0.07
343 0.07
344 0.08
345 0.09
346 0.07
347 0.06
348 0.07
349 0.07
350 0.07
351 0.08
352 0.08
353 0.07
354 0.08
355 0.08
356 0.07
357 0.07
358 0.07
359 0.07
360 0.07
361 0.06
362 0.11
363 0.11
364 0.12
365 0.19
366 0.23
367 0.27
368 0.28
369 0.31
370 0.27
371 0.29
372 0.3
373 0.25
374 0.26
375 0.23
376 0.21
377 0.18
378 0.17
379 0.18
380 0.17
381 0.17
382 0.14
383 0.15
384 0.15
385 0.16
386 0.17
387 0.18
388 0.19
389 0.17
390 0.15
391 0.12
392 0.14
393 0.15
394 0.14
395 0.11
396 0.09
397 0.09
398 0.1
399 0.11
400 0.1
401 0.13
402 0.2
403 0.22
404 0.24
405 0.24
406 0.26
407 0.25
408 0.25
409 0.22
410 0.15
411 0.14
412 0.11
413 0.12
414 0.09
415 0.09
416 0.08
417 0.07
418 0.06
419 0.05
420 0.04