Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N4Q6

Protein Details
Accession G9N4Q6    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
29-54APLQRPKFLQRVKHRSRPLRRFKLSDHydrophilic
NLS Segment(s)
PositionSequence
9-51QKPVTAKPKMAIAAEGKALRAPLQRPKFLQRVKHRSRPLRRFK
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000164  Histone_H3/CENP-A  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
Amino Acid Sequences MARIKQKAQKPVTAKPKMAIAAEGKALRAPLQRPKFLQRVKHRSRPLRRFKLSDMALQKMRKYRTKSLLLPETAFMRLARDIAHEALRERLSFTNRALEGLQASCEQFTISYFTVLRLCADHAMRKTILLEDSNLVKGLMGVTTPTHPICEKPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.58
3 0.58
4 0.52
5 0.46
6 0.4
7 0.32
8 0.27
9 0.29
10 0.28
11 0.22
12 0.2
13 0.2
14 0.19
15 0.21
16 0.23
17 0.29
18 0.35
19 0.39
20 0.43
21 0.5
22 0.56
23 0.57
24 0.63
25 0.64
26 0.68
27 0.72
28 0.78
29 0.8
30 0.81
31 0.87
32 0.87
33 0.87
34 0.87
35 0.84
36 0.79
37 0.74
38 0.72
39 0.63
40 0.59
41 0.52
42 0.46
43 0.45
44 0.42
45 0.41
46 0.37
47 0.4
48 0.4
49 0.43
50 0.47
51 0.49
52 0.55
53 0.56
54 0.57
55 0.59
56 0.53
57 0.47
58 0.4
59 0.33
60 0.26
61 0.23
62 0.15
63 0.1
64 0.09
65 0.08
66 0.08
67 0.08
68 0.09
69 0.1
70 0.11
71 0.1
72 0.11
73 0.14
74 0.14
75 0.13
76 0.14
77 0.15
78 0.17
79 0.19
80 0.19
81 0.22
82 0.21
83 0.22
84 0.2
85 0.18
86 0.17
87 0.15
88 0.15
89 0.1
90 0.1
91 0.09
92 0.09
93 0.08
94 0.06
95 0.07
96 0.1
97 0.09
98 0.11
99 0.12
100 0.13
101 0.14
102 0.14
103 0.14
104 0.11
105 0.12
106 0.14
107 0.16
108 0.21
109 0.21
110 0.25
111 0.25
112 0.24
113 0.24
114 0.23
115 0.23
116 0.19
117 0.19
118 0.17
119 0.2
120 0.2
121 0.19
122 0.16
123 0.13
124 0.12
125 0.11
126 0.09
127 0.06
128 0.07
129 0.08
130 0.1
131 0.13
132 0.13
133 0.16
134 0.16