Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7QH25

Protein Details
Accession A0A4Y7QH25    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-62RDDARRAEKRRRREEELRESLRKBasic
NLS Segment(s)
PositionSequence
44-62RRAEKRRRREEELRESLRK
Subcellular Location(s) mito 10.5, cyto_mito 7.5, plas 6, nucl 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031568  Pet117  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF15786  PET117  
Amino Acid Sequences MTRAAKATLIGAVIASSLTIWAVHFQQRREHETMYQGVLRDDARRAEKRRRREEELRESLRKKESYERVQAVKQQEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.08
10 0.14
11 0.18
12 0.19
13 0.26
14 0.31
15 0.37
16 0.38
17 0.38
18 0.33
19 0.33
20 0.33
21 0.28
22 0.25
23 0.19
24 0.16
25 0.16
26 0.14
27 0.12
28 0.11
29 0.13
30 0.18
31 0.24
32 0.29
33 0.39
34 0.46
35 0.55
36 0.65
37 0.69
38 0.72
39 0.75
40 0.8
41 0.8
42 0.83
43 0.8
44 0.78
45 0.72
46 0.69
47 0.67
48 0.58
49 0.51
50 0.51
51 0.53
52 0.54
53 0.61
54 0.62
55 0.6
56 0.62
57 0.65