Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PJU1

Protein Details
Accession A0A4Y7PJU1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-63GSTLRSRSRERHRKREEIPRRSABasic
NLS Segment(s)
PositionSequence
47-57RSRERHRKREE
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MRRTRVFVRAGGRSRKADWSEHNEREYEEITEEDVCGCEGGSTLRSRSRERHRKREEIPRRSALSTYGVGEPSTGWIELRRDGSVPRFLKFICQFRETAWYLEAFDEPFMNEMSARDSEFVILIPEDVQSQHGTLCILGDMVRQSTPIRAAVNDEGSQALSHVID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.56
4 0.53
5 0.53
6 0.53
7 0.58
8 0.59
9 0.58
10 0.5
11 0.48
12 0.44
13 0.38
14 0.3
15 0.21
16 0.16
17 0.15
18 0.15
19 0.14
20 0.11
21 0.1
22 0.08
23 0.07
24 0.06
25 0.05
26 0.05
27 0.06
28 0.08
29 0.09
30 0.12
31 0.17
32 0.2
33 0.24
34 0.33
35 0.43
36 0.52
37 0.59
38 0.68
39 0.72
40 0.78
41 0.82
42 0.84
43 0.84
44 0.82
45 0.8
46 0.75
47 0.7
48 0.62
49 0.55
50 0.45
51 0.38
52 0.29
53 0.24
54 0.18
55 0.15
56 0.14
57 0.13
58 0.11
59 0.09
60 0.09
61 0.07
62 0.06
63 0.07
64 0.09
65 0.11
66 0.12
67 0.11
68 0.11
69 0.12
70 0.15
71 0.22
72 0.22
73 0.2
74 0.2
75 0.19
76 0.26
77 0.29
78 0.33
79 0.29
80 0.29
81 0.29
82 0.29
83 0.35
84 0.3
85 0.26
86 0.21
87 0.17
88 0.16
89 0.16
90 0.16
91 0.1
92 0.09
93 0.07
94 0.07
95 0.07
96 0.07
97 0.06
98 0.06
99 0.06
100 0.09
101 0.09
102 0.1
103 0.1
104 0.09
105 0.1
106 0.1
107 0.09
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.08
116 0.08
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.06
124 0.06
125 0.06
126 0.07
127 0.08
128 0.1
129 0.1
130 0.11
131 0.12
132 0.14
133 0.16
134 0.18
135 0.18
136 0.17
137 0.22
138 0.25
139 0.29
140 0.27
141 0.26
142 0.23
143 0.22
144 0.22
145 0.17