Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R5XI87

Protein Details
Accession A0A4R5XI87    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-40RVYIPPIYRRTRYRRSRKHRHVPRARWAEPABasic
58-91KIEKRSSTRRWRRTSTRWRWRRRRQPHLLFHDEPBasic
NLS Segment(s)
PositionSequence
18-39RRTRYRRSRKHRHVPRARWAEP
52-81AKKKVVKIEKRSSTRRWRRTSTRWRWRRRR
Subcellular Location(s) mito_nucl 13.666, nucl 13, mito 12, cyto_nucl 8.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MPSTNDNPRRVYIPPIYRRTRYRRSRKHRHVPRARWAEPAKINAIDFIVESAKKKVVKIEKRSSTRRWRRTSTRWRWRRRRQPHLLFHDEPTNHLDFGAVVWLEADLSTYNHVLVVTSHSQDSVCTNIMELTPKKKKVYYTGNHTTSVRTKNENEVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.63
4 0.67
5 0.74
6 0.76
7 0.77
8 0.78
9 0.8
10 0.82
11 0.86
12 0.91
13 0.92
14 0.94
15 0.95
16 0.95
17 0.95
18 0.93
19 0.93
20 0.91
21 0.81
22 0.79
23 0.71
24 0.67
25 0.6
26 0.55
27 0.47
28 0.38
29 0.37
30 0.28
31 0.26
32 0.18
33 0.13
34 0.11
35 0.1
36 0.09
37 0.1
38 0.11
39 0.15
40 0.16
41 0.17
42 0.23
43 0.31
44 0.4
45 0.48
46 0.56
47 0.61
48 0.68
49 0.74
50 0.76
51 0.77
52 0.78
53 0.78
54 0.75
55 0.74
56 0.75
57 0.8
58 0.82
59 0.82
60 0.83
61 0.83
62 0.86
63 0.9
64 0.92
65 0.92
66 0.91
67 0.91
68 0.91
69 0.91
70 0.9
71 0.87
72 0.84
73 0.75
74 0.66
75 0.61
76 0.5
77 0.41
78 0.35
79 0.28
80 0.19
81 0.17
82 0.16
83 0.09
84 0.1
85 0.1
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.04
94 0.05
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.06
101 0.06
102 0.11
103 0.12
104 0.13
105 0.13
106 0.13
107 0.13
108 0.14
109 0.15
110 0.13
111 0.12
112 0.11
113 0.11
114 0.12
115 0.13
116 0.19
117 0.2
118 0.27
119 0.34
120 0.39
121 0.43
122 0.45
123 0.49
124 0.52
125 0.6
126 0.59
127 0.61
128 0.66
129 0.66
130 0.66
131 0.62
132 0.58
133 0.54
134 0.52
135 0.47
136 0.43
137 0.43