Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R5XF37

Protein Details
Accession A0A4R5XF37    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
46-68LKTGSKIQYNAKRRHWRRTKLNIHydrophilic
NLS Segment(s)
PositionSequence
57-63KRRHWRR
Subcellular Location(s) mito 16.5, mito_nucl 13.666, nucl 9.5, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MVSRTLPESVFRTKPFSQPSQKTFRTKRILAKASRQNRPIPQWFRLKTGSKIQYNAKRRHWRRTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.5
4 0.53
5 0.56
6 0.6
7 0.62
8 0.66
9 0.69
10 0.68
11 0.69
12 0.66
13 0.63
14 0.65
15 0.66
16 0.67
17 0.61
18 0.64
19 0.64
20 0.65
21 0.66
22 0.61
23 0.56
24 0.54
25 0.57
26 0.57
27 0.53
28 0.51
29 0.55
30 0.53
31 0.53
32 0.54
33 0.52
34 0.47
35 0.52
36 0.54
37 0.48
38 0.51
39 0.56
40 0.59
41 0.65
42 0.69
43 0.7
44 0.73
45 0.75
46 0.82
47 0.84
48 0.84