Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PYU8

Protein Details
Accession A0A4Y7PYU8    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
183-204SEFWRELRPAPRSKPRKPAPGGHydrophilic
NLS Segment(s)
PositionSequence
190-204RPAPRSKPRKPAPGG
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MGPHPCFGPTPPDFPRDLAQRLGTQSRTGAVFHGPYMPETIRGPETSPQSSRTGGPSREAHHGAAHGAFLPTRLPGGPPLATPSSLRPYAYPQPTLSYNRPPLARPSPLGPYAYTQPTMAPGGSPLAGPSSGPYAYTQPSPLPGGPPFAGPSSLRPNVYIQPTDPRVFSTNEPNYPTVGSNDSEFWRELRPAPRSKPRKPAPGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.4
4 0.4
5 0.37
6 0.36
7 0.36
8 0.39
9 0.42
10 0.37
11 0.32
12 0.29
13 0.28
14 0.26
15 0.22
16 0.19
17 0.16
18 0.16
19 0.15
20 0.18
21 0.16
22 0.16
23 0.19
24 0.18
25 0.17
26 0.17
27 0.2
28 0.18
29 0.19
30 0.2
31 0.21
32 0.26
33 0.28
34 0.29
35 0.29
36 0.3
37 0.3
38 0.29
39 0.31
40 0.33
41 0.29
42 0.33
43 0.34
44 0.34
45 0.39
46 0.39
47 0.34
48 0.28
49 0.27
50 0.23
51 0.19
52 0.16
53 0.11
54 0.09
55 0.08
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.08
63 0.11
64 0.11
65 0.1
66 0.14
67 0.15
68 0.15
69 0.15
70 0.17
71 0.18
72 0.19
73 0.19
74 0.16
75 0.21
76 0.27
77 0.29
78 0.28
79 0.25
80 0.26
81 0.29
82 0.33
83 0.31
84 0.3
85 0.31
86 0.31
87 0.32
88 0.3
89 0.33
90 0.33
91 0.32
92 0.26
93 0.25
94 0.26
95 0.26
96 0.26
97 0.21
98 0.18
99 0.19
100 0.19
101 0.17
102 0.14
103 0.13
104 0.13
105 0.14
106 0.11
107 0.08
108 0.07
109 0.07
110 0.08
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.08
118 0.07
119 0.08
120 0.09
121 0.11
122 0.12
123 0.13
124 0.14
125 0.12
126 0.14
127 0.16
128 0.15
129 0.16
130 0.15
131 0.18
132 0.17
133 0.18
134 0.17
135 0.16
136 0.17
137 0.15
138 0.19
139 0.23
140 0.26
141 0.25
142 0.25
143 0.28
144 0.31
145 0.35
146 0.32
147 0.26
148 0.31
149 0.35
150 0.35
151 0.32
152 0.31
153 0.29
154 0.3
155 0.31
156 0.33
157 0.35
158 0.38
159 0.42
160 0.39
161 0.38
162 0.37
163 0.35
164 0.27
165 0.23
166 0.2
167 0.18
168 0.2
169 0.2
170 0.21
171 0.21
172 0.19
173 0.2
174 0.22
175 0.26
176 0.32
177 0.38
178 0.45
179 0.54
180 0.63
181 0.69
182 0.75
183 0.8
184 0.81