Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PLW5

Protein Details
Accession A0A4Y7PLW5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-104HVSFERPKKSRPPKKEQHHHSHHATBasic
NLS Segment(s)
PositionSequence
85-94RPKKSRPPKK
Subcellular Location(s) nucl 10.5, cyto_nucl 10, mito 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MFNGGASQHIGGFKAPSPSPRMPTPRPHDPYNGHTPAPGPGGFLAPAPPLFTSASDSGVRTVPRPPMPRTLSAPKLIIPHVSFERPKKSRPPKKEQHHHSHHATHAHHTHHTHHTSTTHLQTTYAPRPEHSHPVPGLVKPPKPAKPVQHVHGNQGSFPVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.22
4 0.29
5 0.33
6 0.37
7 0.43
8 0.49
9 0.49
10 0.58
11 0.63
12 0.66
13 0.67
14 0.66
15 0.65
16 0.62
17 0.63
18 0.62
19 0.58
20 0.47
21 0.42
22 0.39
23 0.34
24 0.32
25 0.25
26 0.16
27 0.13
28 0.14
29 0.13
30 0.13
31 0.11
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.1
38 0.1
39 0.13
40 0.12
41 0.15
42 0.15
43 0.15
44 0.15
45 0.17
46 0.17
47 0.14
48 0.16
49 0.19
50 0.24
51 0.29
52 0.3
53 0.37
54 0.39
55 0.42
56 0.44
57 0.46
58 0.42
59 0.4
60 0.38
61 0.31
62 0.3
63 0.27
64 0.23
65 0.17
66 0.17
67 0.16
68 0.18
69 0.19
70 0.21
71 0.3
72 0.29
73 0.33
74 0.4
75 0.5
76 0.57
77 0.64
78 0.71
79 0.72
80 0.81
81 0.88
82 0.87
83 0.86
84 0.85
85 0.82
86 0.77
87 0.71
88 0.63
89 0.6
90 0.51
91 0.46
92 0.43
93 0.38
94 0.37
95 0.35
96 0.36
97 0.37
98 0.39
99 0.34
100 0.32
101 0.3
102 0.31
103 0.34
104 0.33
105 0.29
106 0.26
107 0.26
108 0.27
109 0.34
110 0.36
111 0.38
112 0.34
113 0.32
114 0.38
115 0.41
116 0.47
117 0.42
118 0.41
119 0.35
120 0.42
121 0.43
122 0.39
123 0.43
124 0.41
125 0.42
126 0.42
127 0.5
128 0.5
129 0.52
130 0.59
131 0.59
132 0.62
133 0.67
134 0.66
135 0.69
136 0.64
137 0.66
138 0.65
139 0.57
140 0.47