Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R5XE79

Protein Details
Accession A0A4R5XE79    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-43PTPTNPTHKCLRKRNLSLRKRTTAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, mito 4, E.R. 2, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKLTLSLVVLAFALPIFAMPTPTNPTHKCLRKRNLSLRKRTTAIARWIPVTPEDPNPNRPLPRTSAHPTQTPQPGILLPEDPGPLGPIDVPGDPGDPWTPDEGGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.07
6 0.08
7 0.11
8 0.17
9 0.2
10 0.26
11 0.27
12 0.31
13 0.38
14 0.46
15 0.53
16 0.58
17 0.65
18 0.68
19 0.76
20 0.83
21 0.85
22 0.85
23 0.86
24 0.84
25 0.8
26 0.71
27 0.64
28 0.58
29 0.54
30 0.52
31 0.47
32 0.4
33 0.36
34 0.34
35 0.33
36 0.28
37 0.24
38 0.18
39 0.16
40 0.21
41 0.21
42 0.24
43 0.27
44 0.3
45 0.29
46 0.29
47 0.29
48 0.27
49 0.28
50 0.31
51 0.34
52 0.39
53 0.4
54 0.41
55 0.4
56 0.42
57 0.46
58 0.4
59 0.34
60 0.27
61 0.25
62 0.22
63 0.22
64 0.17
65 0.12
66 0.13
67 0.12
68 0.11
69 0.11
70 0.1
71 0.09
72 0.09
73 0.08
74 0.08
75 0.09
76 0.09
77 0.11
78 0.11
79 0.12
80 0.12
81 0.14
82 0.14
83 0.14
84 0.15
85 0.16