Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7Q135

Protein Details
Accession A0A4Y7Q135    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-73EYTVRNKSFRWKKNKSVSQTRWETNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 9, extr 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MLREIRTASRAVPWRVAILSFANVWPAHGNIVEFGGLCRVITAVLYRNEYTVRNKSFRWKKNKSVSQTRWETNGSGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.31
4 0.25
5 0.19
6 0.17
7 0.14
8 0.13
9 0.13
10 0.12
11 0.13
12 0.12
13 0.1
14 0.1
15 0.09
16 0.09
17 0.07
18 0.08
19 0.07
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.08
31 0.11
32 0.13
33 0.14
34 0.15
35 0.16
36 0.18
37 0.23
38 0.27
39 0.3
40 0.31
41 0.32
42 0.42
43 0.51
44 0.58
45 0.63
46 0.64
47 0.69
48 0.77
49 0.85
50 0.84
51 0.85
52 0.83
53 0.82
54 0.82
55 0.75
56 0.68
57 0.61
58 0.54