Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QMC3

Protein Details
Accession A0A4Y7QMC3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
161-180SFLIMEKRRRDKEKAARSSSHydrophilic
NLS Segment(s)
PositionSequence
167-177KRRRDKEKAAR
Subcellular Location(s) mito 15, plas 6, nucl 3, extr 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MTEPFRLTLSRNSLRNCAMECDAKQMLFVVSTPTKGWKTTRVATIQRCDQSTGKTALVAEWERNVLKQDRLRMAHSAPSDFTQADEILHKTSSLSANRTFLGANGVTYLWRSGMLSLKLFAEGSDVPVAAFHRRNCLKAQSKSYLEIWPEACAILDMLIVSFLIMEKRRRDKEKAARSSSGGGGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.45
4 0.4
5 0.37
6 0.37
7 0.34
8 0.35
9 0.34
10 0.3
11 0.28
12 0.24
13 0.21
14 0.15
15 0.15
16 0.14
17 0.14
18 0.15
19 0.16
20 0.2
21 0.21
22 0.23
23 0.26
24 0.27
25 0.33
26 0.37
27 0.43
28 0.45
29 0.51
30 0.54
31 0.58
32 0.57
33 0.54
34 0.5
35 0.48
36 0.42
37 0.38
38 0.36
39 0.33
40 0.26
41 0.23
42 0.22
43 0.18
44 0.21
45 0.19
46 0.15
47 0.13
48 0.14
49 0.14
50 0.14
51 0.17
52 0.15
53 0.2
54 0.22
55 0.27
56 0.32
57 0.34
58 0.35
59 0.35
60 0.34
61 0.33
62 0.31
63 0.26
64 0.2
65 0.19
66 0.18
67 0.16
68 0.15
69 0.11
70 0.1
71 0.09
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.07
78 0.09
79 0.13
80 0.13
81 0.15
82 0.15
83 0.17
84 0.17
85 0.18
86 0.16
87 0.12
88 0.13
89 0.1
90 0.09
91 0.08
92 0.08
93 0.07
94 0.08
95 0.08
96 0.05
97 0.05
98 0.05
99 0.06
100 0.1
101 0.12
102 0.12
103 0.13
104 0.13
105 0.13
106 0.13
107 0.11
108 0.1
109 0.08
110 0.1
111 0.1
112 0.09
113 0.09
114 0.1
115 0.11
116 0.12
117 0.17
118 0.15
119 0.24
120 0.26
121 0.29
122 0.31
123 0.4
124 0.45
125 0.48
126 0.55
127 0.53
128 0.54
129 0.55
130 0.54
131 0.49
132 0.41
133 0.37
134 0.31
135 0.25
136 0.22
137 0.19
138 0.16
139 0.12
140 0.11
141 0.07
142 0.06
143 0.05
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.08
151 0.13
152 0.18
153 0.27
154 0.37
155 0.46
156 0.52
157 0.59
158 0.66
159 0.73
160 0.79
161 0.81
162 0.78
163 0.74
164 0.7
165 0.67