Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PIQ8

Protein Details
Accession A0A4Y7PIQ8    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-40SLGFLPRKRAARRRGKVNSFPKVSHydrophilic
NLS Segment(s)
PositionSequence
23-32RKRAARRRGK
Subcellular Location(s) mito 13, cyto 8, cyto_nucl 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045077  L3_arc_euk  
IPR000597  Ribosomal_L3  
IPR044892  Ribosomal_L3_dom_3_arc_sf  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00297  Ribosomal_L3  
Amino Acid Sequences MQTLIFAVWYEASHHGSLGFLPRKRAARRRGKVNSFPKVSIKYILLNYDPKKPVHLTAVVGYKANMIQPTTLSRYAVRDLDRPGSKMHKREVVEAVTIIETPPMIVVGDVGYVETPRGHRTLTTVGHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.15
5 0.21
6 0.25
7 0.24
8 0.28
9 0.34
10 0.42
11 0.5
12 0.58
13 0.6
14 0.64
15 0.7
16 0.77
17 0.82
18 0.82
19 0.84
20 0.85
21 0.83
22 0.76
23 0.7
24 0.65
25 0.59
26 0.51
27 0.44
28 0.36
29 0.3
30 0.28
31 0.27
32 0.24
33 0.27
34 0.27
35 0.32
36 0.33
37 0.3
38 0.31
39 0.3
40 0.29
41 0.26
42 0.26
43 0.19
44 0.2
45 0.24
46 0.21
47 0.2
48 0.18
49 0.15
50 0.13
51 0.13
52 0.1
53 0.07
54 0.06
55 0.07
56 0.1
57 0.13
58 0.14
59 0.14
60 0.14
61 0.16
62 0.18
63 0.2
64 0.19
65 0.19
66 0.21
67 0.27
68 0.28
69 0.27
70 0.28
71 0.34
72 0.37
73 0.39
74 0.41
75 0.41
76 0.4
77 0.44
78 0.46
79 0.39
80 0.35
81 0.3
82 0.27
83 0.2
84 0.18
85 0.14
86 0.09
87 0.07
88 0.06
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.06
101 0.08
102 0.09
103 0.12
104 0.14
105 0.14
106 0.15
107 0.19
108 0.27