Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PZN7

Protein Details
Accession A0A4Y7PZN7    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-31KPNAQSIRWRDRRCRTVSRPRIVRPRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MTIAKPNAQSIRWRDRRCRTVSRPRIVRPRLSPSTQIKFNLHSSRTTRSRTRVEWRRHTSCDADSNDGSGDRNVDYGRVGNSRHVGRLLIPQEGTSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.72
3 0.78
4 0.78
5 0.8
6 0.79
7 0.81
8 0.84
9 0.84
10 0.83
11 0.82
12 0.85
13 0.79
14 0.77
15 0.72
16 0.71
17 0.66
18 0.61
19 0.6
20 0.57
21 0.58
22 0.54
23 0.51
24 0.43
25 0.41
26 0.44
27 0.42
28 0.35
29 0.34
30 0.33
31 0.37
32 0.4
33 0.42
34 0.4
35 0.4
36 0.44
37 0.44
38 0.52
39 0.54
40 0.58
41 0.64
42 0.68
43 0.68
44 0.66
45 0.64
46 0.57
47 0.51
48 0.5
49 0.42
50 0.38
51 0.32
52 0.29
53 0.27
54 0.24
55 0.21
56 0.14
57 0.13
58 0.08
59 0.1
60 0.09
61 0.09
62 0.09
63 0.1
64 0.13
65 0.15
66 0.16
67 0.19
68 0.25
69 0.26
70 0.28
71 0.27
72 0.25
73 0.24
74 0.32
75 0.3
76 0.28
77 0.26