Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7QL00

Protein Details
Accession A0A4Y7QL00    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSRKPGPTRRKEPLETTBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRKPGPTRRK
Subcellular Location(s) mito 14.5, mito_nucl 13.666, nucl 11.5, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPGPTRRKEPLETTFTCIFCNHDKSVNVKVDRKEGLAQLQCRVCGQRYQGKVNHLTEPIDVYSEWIDAADAAQKEVKDVRRSAPSVSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.89
4 0.82
5 0.79
6 0.75
7 0.71
8 0.63
9 0.6
10 0.55
11 0.47
12 0.43
13 0.36
14 0.31
15 0.28
16 0.3
17 0.26
18 0.25
19 0.27
20 0.29
21 0.36
22 0.4
23 0.39
24 0.4
25 0.4
26 0.4
27 0.39
28 0.37
29 0.32
30 0.26
31 0.28
32 0.27
33 0.27
34 0.26
35 0.25
36 0.24
37 0.22
38 0.22
39 0.17
40 0.16
41 0.19
42 0.22
43 0.25
44 0.31
45 0.34
46 0.37
47 0.42
48 0.42
49 0.41
50 0.35
51 0.32
52 0.27
53 0.25
54 0.21
55 0.16
56 0.13
57 0.11
58 0.11
59 0.1
60 0.09
61 0.07
62 0.07
63 0.05
64 0.06
65 0.09
66 0.09
67 0.1
68 0.12
69 0.12
70 0.14
71 0.2
72 0.27
73 0.28
74 0.31
75 0.35
76 0.42
77 0.44
78 0.47