Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PI67

Protein Details
Accession A0A4Y7PI67    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
303-334RAEDRDSRKALKKERKELKKEQRAIRRQIRAFBasic
NLS Segment(s)
PositionSequence
309-329SRKALKKERKELKKEQRAIRR
Subcellular Location(s) nucl 10, mito 8.5, cyto_mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006703  G_AIG1  
IPR045058  GIMA/IAN/Toc  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF04548  AIG1  
Amino Acid Sequences MSCNVELQVLVSASWTRHHRVFSETYKTPFRHETSTILDFTSNIYRYSVHNGLGFTWAAGYNCLLTFLQSDRIMGATGAGKSSFVNTVTDHETNLAVGHALDSCTKEIQEVHLKRGGKSVVLVDTPGFGDSSLSDTSVLRLIARHLKTSYKAGVKLTGVIYMHRISDSSFPSGPESNFRMFQELCGADHLKHVVILTTRWENVEMQVALERERQLKTNQTLFKPMIGCGAHMMRYDNVLASAQGVLDYLLEKDTVVLCIQRQLIKEKRALPTTDAWSVLNPNPIAEMRHCHELLVEVQEKLDRAEDRDSRKALKKERKELKKEQRAIRRQIRAFASTLNDPGLLSRLLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.24
4 0.28
5 0.31
6 0.31
7 0.36
8 0.44
9 0.45
10 0.5
11 0.5
12 0.51
13 0.57
14 0.56
15 0.55
16 0.54
17 0.5
18 0.47
19 0.45
20 0.45
21 0.44
22 0.46
23 0.42
24 0.35
25 0.31
26 0.25
27 0.26
28 0.28
29 0.22
30 0.19
31 0.19
32 0.19
33 0.21
34 0.29
35 0.28
36 0.23
37 0.25
38 0.24
39 0.24
40 0.26
41 0.23
42 0.15
43 0.14
44 0.13
45 0.11
46 0.11
47 0.11
48 0.09
49 0.09
50 0.11
51 0.1
52 0.09
53 0.11
54 0.12
55 0.17
56 0.16
57 0.16
58 0.15
59 0.15
60 0.15
61 0.13
62 0.13
63 0.1
64 0.1
65 0.1
66 0.1
67 0.1
68 0.1
69 0.11
70 0.12
71 0.1
72 0.11
73 0.11
74 0.14
75 0.19
76 0.2
77 0.18
78 0.17
79 0.17
80 0.15
81 0.15
82 0.11
83 0.06
84 0.05
85 0.06
86 0.05
87 0.06
88 0.07
89 0.08
90 0.09
91 0.1
92 0.1
93 0.1
94 0.1
95 0.15
96 0.24
97 0.25
98 0.27
99 0.31
100 0.33
101 0.32
102 0.37
103 0.32
104 0.22
105 0.22
106 0.2
107 0.18
108 0.17
109 0.17
110 0.12
111 0.12
112 0.11
113 0.1
114 0.08
115 0.06
116 0.06
117 0.05
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.09
124 0.1
125 0.1
126 0.07
127 0.07
128 0.1
129 0.17
130 0.18
131 0.2
132 0.2
133 0.22
134 0.24
135 0.27
136 0.3
137 0.26
138 0.27
139 0.25
140 0.27
141 0.25
142 0.25
143 0.22
144 0.19
145 0.15
146 0.13
147 0.15
148 0.12
149 0.12
150 0.1
151 0.1
152 0.08
153 0.12
154 0.14
155 0.14
156 0.14
157 0.14
158 0.17
159 0.18
160 0.17
161 0.17
162 0.18
163 0.17
164 0.18
165 0.18
166 0.19
167 0.17
168 0.17
169 0.19
170 0.16
171 0.15
172 0.15
173 0.16
174 0.13
175 0.14
176 0.14
177 0.09
178 0.09
179 0.09
180 0.08
181 0.07
182 0.08
183 0.1
184 0.11
185 0.11
186 0.12
187 0.13
188 0.12
189 0.12
190 0.15
191 0.12
192 0.11
193 0.13
194 0.13
195 0.13
196 0.15
197 0.16
198 0.15
199 0.15
200 0.17
201 0.17
202 0.25
203 0.28
204 0.34
205 0.37
206 0.36
207 0.4
208 0.39
209 0.4
210 0.34
211 0.29
212 0.27
213 0.22
214 0.2
215 0.18
216 0.18
217 0.16
218 0.16
219 0.17
220 0.12
221 0.13
222 0.13
223 0.11
224 0.1
225 0.09
226 0.08
227 0.07
228 0.07
229 0.06
230 0.05
231 0.05
232 0.04
233 0.04
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.06
240 0.06
241 0.07
242 0.07
243 0.08
244 0.08
245 0.12
246 0.15
247 0.17
248 0.18
249 0.26
250 0.33
251 0.37
252 0.42
253 0.45
254 0.49
255 0.51
256 0.51
257 0.46
258 0.45
259 0.45
260 0.42
261 0.36
262 0.3
263 0.27
264 0.29
265 0.28
266 0.27
267 0.22
268 0.19
269 0.2
270 0.21
271 0.22
272 0.2
273 0.23
274 0.21
275 0.28
276 0.28
277 0.26
278 0.25
279 0.25
280 0.25
281 0.26
282 0.25
283 0.19
284 0.19
285 0.21
286 0.21
287 0.19
288 0.22
289 0.16
290 0.17
291 0.26
292 0.31
293 0.37
294 0.45
295 0.47
296 0.5
297 0.57
298 0.63
299 0.65
300 0.7
301 0.73
302 0.76
303 0.84
304 0.87
305 0.87
306 0.9
307 0.91
308 0.91
309 0.9
310 0.89
311 0.89
312 0.88
313 0.9
314 0.88
315 0.87
316 0.8
317 0.78
318 0.74
319 0.66
320 0.58
321 0.52
322 0.46
323 0.39
324 0.37
325 0.31
326 0.25
327 0.22
328 0.21
329 0.2
330 0.16