Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7Q761

Protein Details
Accession A0A4Y7Q761    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-53LLSLSKPQHRHPTPRPPKSKPVQLSTHydrophilic
NLS Segment(s)
PositionSequence
41-47PRPPKSK
57-70PEKPKGRASPAKDK
157-166KAKRSPSPIK
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MKLLAASHRRNPSAPVVTHVQPTKTPGLLSLSKPQHRHPTPRPPKSKPVQLSTTPSPEKPKGRASPAKDKSARSSSNVHNGHGPNRSHQPSPPPLSLPEQPALSDSDLVVANPVISNSILAKPAAPTLTAPSGRLAKRRNRASATTAPNTTSTPPPKAKRSPSPIKARPVPVPVPVSKNPRTSATMPLSRSVPVPSIRPPRTPVRRPTADREFPVCDDNDSDAEPTTPVHGHGVTWQQSNIFDSSDHDDIFGPRTAPLSSHTATARHYFPSPVPSPTPSPRHRPSHARSPSHPTDALFNMSFDSSSDNEFASGHTDDIRALFGLLPNRRRERPVSTSALKGNSKNSLYASSTFQNSPSPEALPPPSFSFPADGTTPTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.43
4 0.43
5 0.48
6 0.47
7 0.41
8 0.34
9 0.38
10 0.38
11 0.33
12 0.31
13 0.27
14 0.3
15 0.32
16 0.34
17 0.39
18 0.43
19 0.49
20 0.52
21 0.56
22 0.61
23 0.63
24 0.7
25 0.7
26 0.72
27 0.77
28 0.84
29 0.88
30 0.84
31 0.87
32 0.86
33 0.86
34 0.82
35 0.79
36 0.75
37 0.72
38 0.72
39 0.68
40 0.68
41 0.61
42 0.56
43 0.56
44 0.56
45 0.57
46 0.54
47 0.58
48 0.56
49 0.62
50 0.68
51 0.68
52 0.72
53 0.72
54 0.77
55 0.72
56 0.68
57 0.66
58 0.67
59 0.62
60 0.54
61 0.55
62 0.5
63 0.56
64 0.54
65 0.47
66 0.45
67 0.44
68 0.46
69 0.46
70 0.42
71 0.36
72 0.43
73 0.46
74 0.41
75 0.41
76 0.45
77 0.46
78 0.51
79 0.49
80 0.42
81 0.41
82 0.44
83 0.45
84 0.41
85 0.34
86 0.28
87 0.25
88 0.24
89 0.24
90 0.2
91 0.16
92 0.12
93 0.11
94 0.11
95 0.11
96 0.1
97 0.08
98 0.07
99 0.06
100 0.07
101 0.05
102 0.05
103 0.06
104 0.07
105 0.09
106 0.09
107 0.09
108 0.1
109 0.1
110 0.12
111 0.11
112 0.1
113 0.09
114 0.11
115 0.17
116 0.17
117 0.17
118 0.17
119 0.24
120 0.25
121 0.31
122 0.35
123 0.39
124 0.47
125 0.54
126 0.58
127 0.57
128 0.58
129 0.59
130 0.6
131 0.58
132 0.53
133 0.47
134 0.41
135 0.37
136 0.35
137 0.3
138 0.28
139 0.24
140 0.27
141 0.33
142 0.37
143 0.43
144 0.49
145 0.54
146 0.57
147 0.63
148 0.67
149 0.68
150 0.74
151 0.73
152 0.73
153 0.71
154 0.66
155 0.6
156 0.55
157 0.49
158 0.42
159 0.39
160 0.34
161 0.35
162 0.36
163 0.39
164 0.39
165 0.41
166 0.38
167 0.37
168 0.39
169 0.35
170 0.37
171 0.35
172 0.36
173 0.33
174 0.33
175 0.31
176 0.27
177 0.26
178 0.2
179 0.17
180 0.13
181 0.15
182 0.2
183 0.29
184 0.31
185 0.32
186 0.35
187 0.42
188 0.5
189 0.55
190 0.56
191 0.55
192 0.6
193 0.62
194 0.67
195 0.66
196 0.62
197 0.57
198 0.53
199 0.47
200 0.4
201 0.38
202 0.3
203 0.21
204 0.18
205 0.17
206 0.14
207 0.12
208 0.11
209 0.09
210 0.09
211 0.09
212 0.08
213 0.08
214 0.07
215 0.07
216 0.08
217 0.08
218 0.08
219 0.11
220 0.17
221 0.17
222 0.18
223 0.18
224 0.17
225 0.18
226 0.19
227 0.17
228 0.11
229 0.09
230 0.11
231 0.15
232 0.16
233 0.15
234 0.14
235 0.14
236 0.14
237 0.17
238 0.16
239 0.12
240 0.11
241 0.12
242 0.12
243 0.12
244 0.14
245 0.16
246 0.16
247 0.18
248 0.19
249 0.19
250 0.21
251 0.24
252 0.23
253 0.2
254 0.2
255 0.19
256 0.2
257 0.26
258 0.26
259 0.26
260 0.27
261 0.28
262 0.33
263 0.38
264 0.46
265 0.43
266 0.5
267 0.54
268 0.6
269 0.63
270 0.67
271 0.66
272 0.68
273 0.73
274 0.7
275 0.67
276 0.68
277 0.68
278 0.63
279 0.58
280 0.47
281 0.42
282 0.38
283 0.38
284 0.29
285 0.24
286 0.19
287 0.18
288 0.17
289 0.13
290 0.14
291 0.11
292 0.12
293 0.13
294 0.12
295 0.12
296 0.12
297 0.13
298 0.13
299 0.13
300 0.11
301 0.12
302 0.12
303 0.12
304 0.13
305 0.13
306 0.09
307 0.09
308 0.09
309 0.11
310 0.19
311 0.25
312 0.31
313 0.38
314 0.45
315 0.47
316 0.51
317 0.54
318 0.55
319 0.56
320 0.58
321 0.58
322 0.55
323 0.57
324 0.57
325 0.59
326 0.55
327 0.5
328 0.47
329 0.46
330 0.44
331 0.4
332 0.38
333 0.35
334 0.34
335 0.34
336 0.34
337 0.3
338 0.33
339 0.32
340 0.31
341 0.31
342 0.3
343 0.32
344 0.29
345 0.28
346 0.25
347 0.29
348 0.34
349 0.31
350 0.32
351 0.33
352 0.34
353 0.33
354 0.33
355 0.31
356 0.26
357 0.27
358 0.26