Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7QPT7

Protein Details
Accession A0A4Y7QPT7    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-48MKQGHVRPKHRVSRLKKYLSBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 11, cyto 9, pero 4
Family & Domain DBs
Amino Acid Sequences LKAEPPFVYNGKPDYDDYQKWVYEAMQYMKQGHVRPKHRVSRLKKYLSDRAANFFMTEVAVNASNTAWTLPMFLRELFNYCFPPNFRNVRRHRFNECAQRGRTVRDYLRDLQDIANSVGDVSPRQLVIRFWDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.33
4 0.35
5 0.36
6 0.34
7 0.31
8 0.3
9 0.25
10 0.21
11 0.24
12 0.22
13 0.22
14 0.23
15 0.25
16 0.27
17 0.31
18 0.32
19 0.36
20 0.41
21 0.43
22 0.51
23 0.59
24 0.64
25 0.69
26 0.75
27 0.75
28 0.77
29 0.81
30 0.79
31 0.76
32 0.74
33 0.73
34 0.69
35 0.67
36 0.57
37 0.52
38 0.46
39 0.4
40 0.33
41 0.25
42 0.19
43 0.13
44 0.11
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.05
57 0.05
58 0.07
59 0.08
60 0.08
61 0.1
62 0.1
63 0.13
64 0.13
65 0.15
66 0.16
67 0.15
68 0.17
69 0.17
70 0.19
71 0.23
72 0.3
73 0.33
74 0.41
75 0.49
76 0.57
77 0.64
78 0.68
79 0.69
80 0.67
81 0.7
82 0.71
83 0.7
84 0.68
85 0.61
86 0.63
87 0.57
88 0.56
89 0.53
90 0.49
91 0.44
92 0.43
93 0.47
94 0.45
95 0.48
96 0.44
97 0.41
98 0.35
99 0.34
100 0.3
101 0.25
102 0.21
103 0.15
104 0.14
105 0.13
106 0.13
107 0.11
108 0.11
109 0.12
110 0.11
111 0.13
112 0.14
113 0.15