Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7Q9H7

Protein Details
Accession A0A4Y7Q9H7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-30GFLKRFFSMGSKKNKKKRNEQPLFDPNLHHydrophilic
NLS Segment(s)
PositionSequence
13-19KKNKKKR
Subcellular Location(s) nucl 14.5, mito_nucl 12.166, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MGFLKRFFSMGSKKNKKKRNEQPLFDPNLHRERRRREEQEQEAVASRLLRSSSAHFAVVSEVDYSSLPPIPHPINTVSSRTTTTSPIRAPSIQSKNSYVVTVHGRMTHSYTEFPNAYPTTPDRDRNDFLEPPRRKSMPDPRKIPVTPRDVNRLNRLRQDPSVVSLLSMYDDHGRLDDNAFSNTPPPHESHLRQSSDGRPQRERRQSTFRELLGEDNGVGDISWAERVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.82
4 0.84
5 0.87
6 0.87
7 0.87
8 0.84
9 0.85
10 0.86
11 0.84
12 0.77
13 0.7
14 0.65
15 0.65
16 0.64
17 0.61
18 0.6
19 0.63
20 0.68
21 0.74
22 0.76
23 0.74
24 0.79
25 0.8
26 0.8
27 0.71
28 0.63
29 0.55
30 0.47
31 0.39
32 0.29
33 0.21
34 0.14
35 0.13
36 0.12
37 0.12
38 0.15
39 0.2
40 0.2
41 0.21
42 0.19
43 0.19
44 0.19
45 0.17
46 0.14
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.11
54 0.1
55 0.09
56 0.14
57 0.15
58 0.16
59 0.17
60 0.18
61 0.21
62 0.23
63 0.25
64 0.22
65 0.23
66 0.23
67 0.23
68 0.22
69 0.22
70 0.22
71 0.24
72 0.24
73 0.25
74 0.26
75 0.25
76 0.26
77 0.31
78 0.35
79 0.34
80 0.35
81 0.35
82 0.35
83 0.35
84 0.32
85 0.23
86 0.19
87 0.19
88 0.18
89 0.17
90 0.16
91 0.16
92 0.16
93 0.18
94 0.17
95 0.15
96 0.14
97 0.14
98 0.15
99 0.15
100 0.15
101 0.16
102 0.15
103 0.14
104 0.14
105 0.15
106 0.18
107 0.21
108 0.26
109 0.26
110 0.31
111 0.33
112 0.34
113 0.38
114 0.34
115 0.35
116 0.4
117 0.39
118 0.39
119 0.43
120 0.41
121 0.38
122 0.43
123 0.5
124 0.5
125 0.57
126 0.57
127 0.54
128 0.6
129 0.59
130 0.57
131 0.53
132 0.51
133 0.47
134 0.46
135 0.51
136 0.5
137 0.54
138 0.57
139 0.57
140 0.53
141 0.55
142 0.56
143 0.52
144 0.47
145 0.49
146 0.4
147 0.35
148 0.34
149 0.26
150 0.22
151 0.18
152 0.16
153 0.12
154 0.11
155 0.09
156 0.09
157 0.09
158 0.1
159 0.1
160 0.11
161 0.1
162 0.12
163 0.14
164 0.13
165 0.15
166 0.15
167 0.15
168 0.18
169 0.18
170 0.19
171 0.18
172 0.19
173 0.23
174 0.3
175 0.33
176 0.39
177 0.47
178 0.48
179 0.49
180 0.51
181 0.51
182 0.55
183 0.58
184 0.55
185 0.55
186 0.61
187 0.69
188 0.75
189 0.76
190 0.73
191 0.76
192 0.76
193 0.76
194 0.75
195 0.65
196 0.59
197 0.52
198 0.48
199 0.4
200 0.35
201 0.26
202 0.19
203 0.18
204 0.13
205 0.12
206 0.09
207 0.06
208 0.06
209 0.07