Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7Q779

Protein Details
Accession A0A4Y7Q779    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-75MLTFMQRRSKRGRSRSRSRSRSRRRSNSPHRRSRRSRSRSRSRSARSRTRSRSRDRKGASBasic
NLS Segment(s)
PositionSequence
22-73RRSKRGRSRSRSRSRSRRRSNSPHRRSRRSRSRSRSRSARSRTRSRSRDRKG
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MAMYVSNTNQSTVINMLTFMQRRSKRGRSRSRSRSRSRRRSNSPHRRSRRSRSRSRSRSARSRTRSRSRDRKGASEPFSRSLGGPMNAEHEEAMEMAKNSKRENRVYVGNLSYDVRYRDLMEFMRGGGWGNTRLVFGFLRDGGKPQLHGRGGDKLLDESACLLGRLQSIFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.17
5 0.19
6 0.2
7 0.28
8 0.3
9 0.36
10 0.45
11 0.54
12 0.58
13 0.67
14 0.76
15 0.77
16 0.84
17 0.89
18 0.92
19 0.92
20 0.92
21 0.93
22 0.93
23 0.94
24 0.94
25 0.93
26 0.92
27 0.93
28 0.94
29 0.94
30 0.93
31 0.93
32 0.92
33 0.92
34 0.9
35 0.9
36 0.9
37 0.88
38 0.89
39 0.88
40 0.9
41 0.88
42 0.88
43 0.88
44 0.85
45 0.85
46 0.83
47 0.83
48 0.8
49 0.81
50 0.82
51 0.82
52 0.82
53 0.82
54 0.84
55 0.8
56 0.82
57 0.74
58 0.71
59 0.68
60 0.68
61 0.63
62 0.58
63 0.54
64 0.46
65 0.44
66 0.38
67 0.31
68 0.24
69 0.21
70 0.16
71 0.14
72 0.11
73 0.14
74 0.13
75 0.13
76 0.11
77 0.09
78 0.08
79 0.07
80 0.07
81 0.05
82 0.05
83 0.07
84 0.09
85 0.11
86 0.12
87 0.18
88 0.22
89 0.25
90 0.29
91 0.3
92 0.33
93 0.35
94 0.36
95 0.32
96 0.28
97 0.26
98 0.22
99 0.19
100 0.16
101 0.15
102 0.13
103 0.13
104 0.15
105 0.14
106 0.16
107 0.17
108 0.17
109 0.16
110 0.14
111 0.14
112 0.12
113 0.12
114 0.1
115 0.11
116 0.11
117 0.12
118 0.12
119 0.12
120 0.12
121 0.13
122 0.12
123 0.11
124 0.13
125 0.13
126 0.15
127 0.15
128 0.18
129 0.2
130 0.21
131 0.23
132 0.23
133 0.29
134 0.29
135 0.31
136 0.32
137 0.36
138 0.36
139 0.35
140 0.33
141 0.26
142 0.26
143 0.24
144 0.21
145 0.14
146 0.16
147 0.14
148 0.13
149 0.12
150 0.12
151 0.14