Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7QIS8

Protein Details
Accession A0A4Y7QIS8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
45-71DGPGGEGEKKRRRQENRQRIREQNFLKBasic
NLS Segment(s)
PositionSequence
53-57KKRRR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences SSCPANTVLTGLNYLKDQEPVLALPDEDYPPWLWKLLDSKVHVDDGPGGEGEKKRRRQENRQRIREQNFLKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.14
5 0.11
6 0.12
7 0.11
8 0.13
9 0.11
10 0.1
11 0.1
12 0.11
13 0.11
14 0.1
15 0.11
16 0.1
17 0.11
18 0.11
19 0.11
20 0.1
21 0.11
22 0.15
23 0.17
24 0.21
25 0.21
26 0.23
27 0.23
28 0.25
29 0.23
30 0.19
31 0.18
32 0.14
33 0.13
34 0.1
35 0.09
36 0.11
37 0.15
38 0.23
39 0.3
40 0.38
41 0.45
42 0.55
43 0.64
44 0.72
45 0.81
46 0.83
47 0.86
48 0.88
49 0.88
50 0.88
51 0.86
52 0.85
53 0.79