Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7Q3A9

Protein Details
Accession A0A4Y7Q3A9    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-116APAARKPKEPKEPKAKVAKVSKKPKKKAASEEEEEBasic
NLS Segment(s)
PositionSequence
16-34RANARSTKAKEDKPEKAKR
77-109PKRGQAPAARKPKEPKEPKAKVAKVSKKPKKKA
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPRTATETTTKTATKRANARSTKAKEDKPEKAKRAPSAYNIFMGTHLKKWREDNPGGLVKEGMAEVAAMWRDSPENPKRGQAPAARKPKEPKEPKAKVAKVSKKPKKKAASEEEEESASAQSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.54
4 0.59
5 0.62
6 0.66
7 0.69
8 0.69
9 0.71
10 0.7
11 0.66
12 0.66
13 0.69
14 0.73
15 0.72
16 0.77
17 0.73
18 0.73
19 0.74
20 0.71
21 0.7
22 0.64
23 0.6
24 0.57
25 0.52
26 0.45
27 0.39
28 0.33
29 0.27
30 0.27
31 0.22
32 0.2
33 0.24
34 0.24
35 0.25
36 0.29
37 0.35
38 0.39
39 0.39
40 0.37
41 0.38
42 0.42
43 0.4
44 0.36
45 0.28
46 0.2
47 0.19
48 0.16
49 0.1
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.06
60 0.15
61 0.19
62 0.24
63 0.25
64 0.28
65 0.3
66 0.32
67 0.37
68 0.36
69 0.41
70 0.46
71 0.55
72 0.55
73 0.57
74 0.63
75 0.66
76 0.7
77 0.69
78 0.69
79 0.7
80 0.74
81 0.77
82 0.8
83 0.75
84 0.73
85 0.75
86 0.76
87 0.75
88 0.8
89 0.82
90 0.82
91 0.87
92 0.88
93 0.87
94 0.86
95 0.86
96 0.85
97 0.84
98 0.79
99 0.75
100 0.68
101 0.58
102 0.49
103 0.4